Conserved Protein Domain Family
TIGR00697

?
TIGR00697: TIGR00697 
conserved hypothetical integral membrane protein
All known members of this family are proteins or 210-250 amino acids in length. Conserved regions of hydrophobicity suggest that all members of the family are integral membrane proteins. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129780
View PSSM: TIGR00697
Aligned: 9 rows
Threshold Bit Score: 184.849
Threshold Setting Gi: 14601849
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4376490    29 RGKAWLTGWLSLlSSIMNVFVLKQIH------------LWGFEVTSADVYVIGLLTCLNYAREHYEKNDINDAMLCSWVI 96
gi 1730901    25 FGKMGLFVWIGFaTVCANLQVVKTVE------------LFGLTATLGNVMYGTIFFATDVLNEKYGPAEARKAVWLGFST 92
gi 1176279    15 RAIIWLSFFHIFiIAASNYFVQIPFEitlkltalgaanDFSFHSTWGTLTFPFIFLATDLTVRIFGAEDARKIIFVVMFP 94
gi 586657     11 KALFWLSLFHLLvITSSNYLVQLPVS------------ILGFHTTWGAFSFPFIFLATDLTVRIFGAPLARRIIFAVMIP 78
gi 499182061  25 FGRTGLYAWTAMaIILANIQVMKTIR------------FFGLVTAMGNIVYGTTFLVTDILCENYGKREAKKAVEVGFFV 92
gi 498416551  24 RNLIMLAAWASLlSIIMNIFVLKQIV------------LFGFEVTAADVYVIGLFSCLNCAREFWGKESTRKVIFVSWCS 91
gi 499192127  25 FKKNGLFAWVAVaIIIANIQVLKQIT------------IFGINATLGNIIYTSSYIATDMLSEFYGEKTSKKAVYIGFIS 92
gi 499194647  14 sylsstftlllvlsnlvlsskLIPTT------------FFNFIIPGGLILYPLTFLISDVVNEIFGPKKARVMIFSAFIA 81
gi 499168525  13 PLVLAAAVF-SVaLVSANYLSAKLFLvei-------pgLITLVGPAGVVAYSVTFIVTDVVSEVYGRRAAGAVVAAGFAS 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4376490    97 SIAFLVLTQLHLFLIPSPNDSSQ-EHFLALFSSTPRIVVASLVTLIFVQIVDIKLFTFLQRVFSK-KYFAMRSTISLLFS 174
gi 1730901    93 LLTLTFVMQGVLLFEPASSDISQ-TALETIFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSdRLLWLRNGGSTAVS 171
gi 1176279    95 ALIVSYVISVLFSESKFQGFESL-THFD-LFVF--RIAIASFAAYVVGQLLDVIVFNRLRQL----KTWWVAPTSSMTFG 166
gi 586657     79 ALLISYVISSLFYMGSWQGFGAL-AHFN-LFVA--RIATASFMAYALGQILDVHVFNRLRQS----RRWWLAPTASTLFG 150
gi 499182061  93 LVVFTLLMQICLAFIPHESDTLS-PHLEQIFGIMPRITVASLTAYLVSQLHDVWAFDFWKRRTKG-RFLWLRNNASTMVS 170
gi 498416551  92 TLSFLILTQLHLHLKPSPGDISQ-LHYEALFAPSLRIISASVITTMIVQFVDFKVFGWLKKHSQG-RVFGLRSACSVALS 169
gi 499192127  93 FIIFAVLTNAQIHFMSNRTQENF-KSLGNIFSSMPALLLASLVAYLISQLNDVYLYQLIKKKFP--RFLFFRTNGSTLIS 169
gi 499194647  82 NLLASSIVQIFMFF-PVASPEMQ-TAWHCLFDLSPLRFLASLLAFIVSQQLDIVLYTFFKNRTPN-SSLWLRSNGSTWIS 158
gi 499168525  85 QIVALFLTAVAIASPPAPFSLVQqEEYAKVVMAGFNIIVASLVAYIVSQYHDVWAFHFWKKMTGS-RWLWLRNNLSTWVS 163
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 4376490   175 QLIDTIIFSFLGLYG--------------LVSNLCDVMIFAMLVKGIVITLAIPTLTVTKAVLDRR 226
gi 1730901   172 QLFDTFIFTAVAFLGi------------yPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPND 225
gi 1176279   167 SMADTFVFFSIAFYQsad---------pfMAEHWAQLGFVDYLFKLFIGIILFVPAYGVVLNVILR 223
gi 586657    151 NVSDTLAFFFIAFWRspd---------afMAEHWMEIALVDYCFKVLISIVFFLPMYGVLLNMLLK 207
gi 499182061 171 QLIDNAVFTWIAFVGfgvfw-----eqvfPWELIAEIFVTSYIMKFIVAALDTPFVYIAKMIKSEA 231
gi 498416551 170 QSIDTVIFSFLGLYG--------------LVANLPDVMMFSLLSKGTALLLASPCVALAKVFYNRL 221
gi 499192127 170 GLIDTTIFVGIATYFkv-----------fPKQAFLNIVIFTYVIKAVAGVLGTPFIYFAKYIKLEK 224
gi 499194647 159 QIPDTFIVDTCILYFgm----------glSFPQTLNIMFYSYIYKITFCVLTTPLFYLAVNTIRKF 214
gi 499168525 164 QLIDTVVFLSLAFYIipllspeasrvepvSLSTLWAMIYSQYIIKLGIAVLDTPVVYLGVYLVKNY 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap