Conserved Protein Domain Family
TIGR00698

?
TIGR00698: TIGR00698 
conserved hypothetical integral membrane protein
Members of this family are found so far only in one archaeal species, Archaeoglobus fulgidus, and in two related bacterial species, Haemophilus influenzae and Escherichia coli. It has 9 GES predicted transmembrane regions at conserved locations in all members. These proteins have a molecular weight of approximately 35 to 38 kDa. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129781
View PSSM: TIGR00698
Aligned: 3 rows
Threshold Bit Score: 374.622
Threshold Setting Gi: 11499213
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465596     14 WHFIPGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNTIYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLT 93
gi 1175855     4 RPFYFGLIFIAIIAVLANYLGSTDFSHHYHISALIIAILLGMAIGNTIYPQFSSQVEKGVLFAKGTLLRAGIVLYGFRLT 83
gi 499181578  14 LPVSRKNLQMLLLLLLCGAAAYIINLADPALEPLFLALVFGIVAGN---LQRDEEKKRVVERYVPFLLPIGITLYGVNIN 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465596     94 FSQIADVGISGIIIDVLTLSSTFLLACFLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIF 173
gi 1175855    84 FGDIADVGLNAVVTDAIMLISTFFLTALLGIRYLKMDKQLVYLTGAGCSICGAAAVMAAEPVTKAESHKVSVAIAVVVIF 163
gi 499181578  91 IPYLGEFHP-EIVAATLISTSLIFLTVFWLSSRLKLSRQMSILLACGSGICGVSAIAIISPLIKPRKEEFSAAIMIITAV 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465596    174 GTVAIFLYPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPFLILLAARVKQLSG 253
gi 1175855   164 GTLSIFTYPFFYTWSQHLINAHQFGIYVGSSVHEVAQVYAIGGNIDPIVANTAVITKMLRVMMLAPFLFMLSWLLTRSDG 243
gi 499181578 170 GLTGAILYPSIAHYAS--ISPDEFAVLAGATLHQTGIVKISSQLFG--VEEEALAIKGIRIAMIALVVLILSIIYS---- 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465596    254 ANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLAMAMAALGLTTHVSALKKAGAKPLLMALVLFAWL 333
gi 1175855   244 ISENTSHKITIPWFAVLFIGVAIFNSFDLLPKELVKLFVEIDSFLLISAMAALGLTTQASAIKKAGLKPLVLGVLIYLWL 323
gi 499181578 242 ----E-SRFYVPWYIVSFLGVALFSST-YLPGEVVQALRPLATVMFATTLAAICYTVNVGRVQRVGVKPLFASYAG--WA 313
                        330
                 ....*....|....*
gi 465596    334 IVGGGAINYVIQSVI 348
gi 1175855   324 VIGGFLVNYGISKLI 338
gi 499181578 314 VGVAFVLLLLGSGAL 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap