1OHV


Conserved Protein Domain Family
GABAtrns_euk

?
TIGR00699: GABAtrns_euk 
Click on image for an interactive view with Cn3D
4-aminobutyrate aminotransferase, eukaryotic type
This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known eukaryotic examples of the enzyme. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so separate models are built for prokaryotic and eukaryotic sets. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129782
View PSSM: TIGR00699
Aligned: 5 rows
Threshold Bit Score: 862.594
Threshold Setting Gi: 1730199
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OHV_A       6 KVDVEFDYDGPLMKTE-VPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPAL 84
gi 120965   34 KPYFPNEPTAPKLATA-IPGPKNKAASEQLNEVFDVRSLNMLADYTKSVGNYIADLDGNMLLDVYAQIASIPVGYNNPHL 112
gi 6016100  11 THFFPNEPQGPSIKTEtIPGPKGKAAAEEMSKYHDISAVKFPVDYEKSIGNYLVDLDGNVLLDVYSQIATIPIGYNNPTL 90
gi 905379   34 KVTFEFDYDGPLMKTE-VPGPRSQELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPAL 112
gi 1730199   5 EQYYPEEPTKPTVKTEsIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDVDGNTYLDLYAQISSIALGYNNPAL 84
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OHV_A      85 VKLVQQPQNVSTFINRPALGILPPENFVEKLREsLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKERG--QSAFS 162
gi 120965  113 LKVAASPEMATSLINRPALGNFPSADWAHILKTgILKVAPKGLDQVFTAMAGSDANETAYKAAFMYYRQQQRGgpEKEFT 192
gi 6016100  91 LKAAKSDEVATILMNRPALGNYPPKEWARVAYEgAIKYAPKGQKYVYFQMSGSDANEIAYKLAMLHHFNNKPRp-TGDYT 169
gi 905379  113 AKLVQQPQNASTFINRPALGILLQRTLWTSSGSpCSRWLPKACVSSSRWPAGPAPMRMAFKTIFMWYRSKERG--QRGFS 190
gi 1730199  85 IKAAQSPEMIRALVDRPALGNFPSKDLDKILKQ-ILKSAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGy-DADFS 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OHV_A     163 KEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCL 242
gi 120965  193 EEEIQSSMLNQTPGSPQLSIMSFKAGFHGRLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHAKENAEEEQRCL 272
gi 6016100 170 AEENESCLNNAAPGSPEVAVLSFRHSFHGRLFGSLSTTRSKPVHKLGMPAFPWPQADFPALKYPLEEHVEENAKEEQRCI 249
gi 905379  191 KEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVTDNQQEEARCL 270
gi 1730199 163 EKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCL 242
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OHV_A     243 EEVEDLIVKYRKKkktVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDPA 322
gi 120965  273 QEAERLIKEWHNP---VAAIIVEPIQSEGGDNHASPAFFRGLREITKRNNVLFIVDEVQTGVGATGKFWAHDHWNLETPP 349
gi 6016100 250 DQVEQILTNHHCP---VVACIIEPIQSEGGDNHASPDFFHKLQATLKKHDVKFIVDEVQTGVGSTGTLWAHEQWNLPYPP 326
gi 905379  271 EEVEDLNVKYRKKkrtVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA 350
gi 1730199 243 AIVEELIKTWSIP---VAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTGVGATGKLWCHEYADIQPPV 319
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OHV_A     323 DVMTFSKKMMTGG-FFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQF 401
gi 120965  350 DMVTFSKKAQTAGyYFGNPALRPNKPYRQFNTWMGDPSRALIFRGIIEEIERLFLVENTAATGDYLYSGLERLAKQYPEH 429
gi 6016100 327 DMVTFSKKFQAAGiFYHDLALRP-HAYQHFNTWMGDPFRAVQSRYILQEIQDKDLLNNVKSVGDFLYAGLEELARKHPGK 405
gi 905379  351 DVMSFSKKMMTGG-FFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLLDLQARYPQF 429
gi 1730199 320 DLVTFSKKFQSAGyFFHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPEN 399
                      410       420       430       440       450       460
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....
1OHV_A     402 ISRVR--GRGTFCSFDTPdesIRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 468
gi 120965  430 LQNLRgkGQGTFIAWDTP---KRDEFLVKGKGVGINIGGSGQNAVRLRPMLIFQKHHADILLESIEKII 495
gi 6016100 406 INNLRgkGKGTFIAWDCEspaARDKFCADMRINGVNIGGCGVAAIRLRPMLVFQKHHAQILLKKIDELI 474
gi 905379  430 VSRVR--GRGTFCSFDTPdeaIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAQLFLNIFSGIL 496
gi 1730199 400 FQNLRgkGRGTFIAWDLPtgeKRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSV 468
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap