Conserved Protein Domain Family
GABAtrnsam

?
TIGR00700: GABAtrnsam 
4-aminobutyrate aminotransferase, prokaryotic type
This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known bacterial examples of the enzyme. The best archaeal matches are presumed but not trusted to have the equivalent function. The degree of sequence difference between this set and known eukaryotic (mitochondrial) examples is greater than the distance to some proteins known to have different functions, and so separate models are built for prokaryotic and eukaryotic sets. E. coli has two isozymes. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129783
View PSSM: TIGR00700
Aligned: 3 rows
Threshold Bit Score: 667.738
Threshold Setting Gi: 2492856
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492856  24 HRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVA 103
gi 6016090  15 QKRDQFVSKGVSNGNRSLAVKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIE 94
gi 1708007   8 QRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVT 87
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492856 104 VAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYR 183
gi 6016090  95 LAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKFGFGPFAPEVYQ 174
gi 1708007  88 LAEKINALAPVSGQAKTAFFTTGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYH 167
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492856 184 APLSYPYRDGLLDKQLATNG-ELAAARAIGVIDkqVGANNLAALVIEPIQGEGGFIVPAEGFLPALLDWCRKNHVVFIAD 262
gi 6016090 175 APFPYYYQKPAGMSDESYDDmVIQAFNDFFIAS--VAPETVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVAD 252
gi 1708007 168 VPYPSDLHGIST--QDSLD-----AIERLFKSD--IEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIAD 238
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492856 263 EVQTGFARTGAMFACEHEGPdglEPDLICTAKGIADGLPLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIE 342
gi 6016090 253 EIQTGFARTGTYFAIEHFDV---VPDLITVSKSLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIE 329
gi 1708007 239 EVQSGFARTGKLFAMDHYAD---KPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIID 315
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492856 343 SDGLIERARQIERLVTDRLTTLQAVDDRIGDVRGRGAMIAVELV-KSGTTEPDAGLTERLATAAHAAGVIILTCGMFGNI 421
gi 6016090 330 EEGLNERSEEIGKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVkDPDTREPDKTKAAAIAAYANQNGLLLLTAGINGNI 409
gi 1708007 316 KESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFN-DPQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNV 394
                      410       420
               ....*....|....*....|....*..
gi 2492856 422 IRLLPPLTIGDELLSEGLDIVCAILAD 448
gi 6016090 410 IRFLTPLVISDSLLNEGLSILEAGLRA 436
gi 1708007 395 IRFLYPLTIPDAQFDAAMKILQDALSD 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap