Conserved Protein Domain Family
dat

?
TIGR00709: dat 
2,4-diaminobutyrate 4-transaminases
This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129792
View PSSM: TIGR00709
Aligned: 3 rows
Threshold Bit Score: 735.218
Threshold Setting Gi: 6685396
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175339  15 QHFLDRQDVMESNVRSYPRKLPFAYAKAQGCWVTDVEGNEYLDFLAGAGTLALGHNHPILMQAIKDVLDSGLPLHTLDLT 94
gi 6685373  15 EYYLTRQSQMESNVRSYPRKLPLAIAKAQGCWVTDVEGTQYLDCLAGAGTLALGHNHPAVIQSIQDTLASGLPLHTLDLT 94
gi 6685396   3 QNDLSVFNEYESEVRSYVRGFPTVFHQAKGYKLWDLDGKEYVDFFSGAGALNYGHNDENMKQKLLTYIQEDGVTHSLDMA 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175339  95 TPLKDAFSEELLSFFP---KDKYILQFTGPSGADANEAAIKLAKTYTGRGNIIAFSGGFHGMTQGALALTGNLGAKNAVE 171
gi 6685373  95 TPLKDAFTEALLAYLPg-gKEEYCLQFCGPSGADATEAAIKLAKTYTGRSSVISFSGGYHGMTHGSLAMTGNLSAKNAVN 173
gi 6685396  83 TKAKGEFIDAFQNIILkprNMDYKIMFPGPTGANSVESALKLARKVTGRTNVVSFTNGFHGMTIGALSVTGNKFKRNGAG 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175339 172 NLMPGVQFMPYPHEYRCPFGIGGEAGAKAVEQYFENFIEDVESGVVKPAAVILEAIQGEGGVVSAPISFLQKVREVTQKH 251
gi 6685373 174 GLMPGVQFMPYPHEYRCPLGLGGEAGVDALTYYFENFIEDVESGVTKPAAVILEAIQGEGGVVTAPVKWLQKIREVTEKH 253
gi 6685396 163 MPLSNTSTLPYDQFLKE---------SNNSIEYIENFLDNGGSGLDKPAAFIVETVQGEGGLNAASSEWLRSIEKICRER 233
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175339 252 GILMIVDEVQAGFCRSGRMFAFEHAGIEPDIIVMSKAVGG-SLPLAVLAIRKEFDAWQPAGHTGTFRGNQLAMATGYASL 330
gi 6685373 254 NIVLILDEVQAGFARSGKMFAFEHAGIEPDVVVMSKAVGG-GLPLAVLGIKRKFDAWQPAGHTGTFRGNQLAMGTGLVVL 332
gi 6685396 234 DIKLILDDVQAGVGRTGTFFSFEPAGIKPDFVCLSKSIGGnGSPLAITLVAPEYDKFAPGEHNGTFRGNNFAFVTGTEAL 313
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175339 331 KIMRDENLAQNAQERGeyltnalrelskEYPCIGNVR-GRGLMMGIDIVDERQSKDATGAYPRDCELAAAIQKACFKNKL 409
gi 6685373 333 ETIKEQNLAQNAQERG------------EFPCIGNVR-GRGLMIGVEIVDERKPADRIGSHPADSQLAAAIQTACFNNNL 399
gi 6685396 314 NYWKDDRLEKNVQEKSeritsflddmikKHPEMKGVRkGRGFMQGIMSPIED--------------LADNIAGRCFEHGL 379
                      410       420       430       440
               ....*....|....*....|....*....|....*....|....*
gi 1175339 410 LLERGGRGGNVVRVLCAVNINQSECEEFIKRFKQSVVDALKVVRS 454
gi 6685373 400 LLEKGGRNGTVIRLLCPLIITQEECVEVIARFKKAVAEALVAVRG 444
gi 6685396 380 IMETAGAEDEVFKLFPPITIDDEGLERGLSILQQAIEEVTAESNL 424
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap