Conserved Protein Domain Family
efflux_EmrB

?
TIGR00711: efflux_EmrB 
drug resistance transporter, EmrB/QacA subfamily
This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129794
View PSSM: TIGR00711
Aligned: 6 rows
Threshold Bit Score: 560.074
Threshold Setting Gi: 15607923
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446    13 VIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIA 92
gi 1169524    17 ILLTLALSLATFMQVLDSTIANVAIPTIAGDLGASFSQGTWVITSFGVANAISIPITGWLAKRFGEVRLFLVSTFLFVVS 96
gi 3915990    13 MSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLIPLSAFLITRFGQRSLFLVAMFCFTLG 92
gi 499183121  14 IFLTVSLMVGVFMAILDTTIVDIIVPRLTGPLSTDLYGVQWVITSYMTAAATGILLVEWLESRIGLKKVFLIGLFLFTTS 93
gi 490733535  16 LLAFFGMIVGMFMSVLDIQIVASSLSVIAAGLAASSDELSWVQTSYLIAEVIIIPITGFLARLLSTRICYFIAALGFTIM 95
gi 685971521  42 LRTAGVCVLASVMAHVDVTVVSVAQRTFVADFGSTQAVVAWTMTGYMLALATVIPTAGWAADRFGTRRLFMGSVLAFTLG 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446    93 SWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFF 172
gi 1169524    97 SWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNYPPEKRGMALAFWSMTIVVAPIFGPILGGWISDNIHWGWIFF 176
gi 3915990    93 TLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFPPESRGKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFY 172
gi 499183121  94 SFFAGRANSLEWMITARTFQGFGESLIVVSAEAMLFSAYPPYKRGLAMGIYGLGVSFAPALGPTLGGWITELIEWRWVFY 173
gi 490733535  96 SVLCSLANNIESMIIFRALQGFFGGAMIPLVFSTVYIIFPASQRPTVTILIGLVVTVAPTLGPTLGGYITEILSWHFMFL 175
gi 685971521 122 SLLCAVAPNILLLIIFRVVQGFGGGMLTPVSFAILAREAGPKRLGRVMAVVGIPMLLGPVGGPILGGWLIGAYGWRWIFL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446   173 INVPIGVAVVLMTLQTLRGrETR--TERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIV 250
gi 1169524   177 INVPIGLSVVLISWKILGSrESE--IVHQPIDKVGLVLLVLGVGCLQLMLDQGREQDWFNSNEIIILAVVAVVCLIALVI 254
gi 3915990   173 GLVPIGAIVIIVAFFIFKN-MVE--PQKIKLDTLGAILSIVGFASLLYGVSEAGSDGWTDP-IVLSTVIIGAIAIVAFVV 248
gi 499183121 174 INIPIGIINFVSALFFLPE-HKP--KHSVSLNFISYFFISVATVSLLIVLSKGQQHGWFSSDFIVKMSFLSLFSFLFFLL 250
gi 490733535 176 LNVIPGIFVCTVVFLYVNF-DKPnyQLLKNFDFLGILLMSLTLGLLQYVLEEGNKEGWLDDNLILFLSITVALGFILLII 254
gi 685971521 202 VNLPVGLSALVLAAIVFPR-DRP--AASENFDYMGLLLLSPGLATFLFGVSSSPARGTMADRHVLIPAITGLALIAAFVA 278
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446   251 W-ELTDDNPIVDLSLFKSRNFTIG-CLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRF- 327
gi 1169524   255 W-ELTDDNPVVDISLFHSRNFSVG-CLCTSLAFLIYLGSVVLIPLLLQQVFHYTATWAGLAASPVGLFPILLSPIIGRF- 331
gi 3915990   249 Q-QLRHDDPMLDFRVFKYDIFSLS-SVINIIITVALYTGMFLLPIYLQNLVGFTALQSGLLLLPGAIVMLIMSPISGIL- 325
gi 499183121 251 S-EMLSRNKLVDPEIFKIKEFTIAfLVYCLLLGFSMYQVFYLLPLFYERLKGLPTFEAGLHILPLALAVGISSPIAGVI- 328
gi 490733535 255 R-ELTFINPILDLKTFLYKDFTFG-CIYSFVMGIGLYGAVYILPLFLFTIAEYDTLQIGATMMVTGVAQFLSAPLAGRMl 332
gi 685971521 279 HsWYRTEHPLIDMRLFQNRAVAQA-NMTMTVLSLGLFGSFLLLPSYLQQVLHQSPMQSGVHIIPQGLGAMLAMPIAGAM- 356
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446   328 AHKLDMRRLVTFSFIMYAVCFYWRAyTFEPGMDFGASAWP-QFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTR 406
gi 1169524   332 GYKIDMRILVTISFIVYAITFYWRAvTFEPSMTFVDVALP-QLVQGLAVSCFFMPLTTITLSGLPAHKMASASSLFNFLR 410
gi 3915990   326 FDKFGPRPLAIIGLLVTVVTTYQYT-QLTIDTPYTHIMLI-YSIRAFGMSLLMMPVMTAGMNQLPARLNSHGTAMSNTLR 403
gi 499183121 329 SDKVSERLPLFIAVVLYLYASFFILpKFNYYTPSWESAFK-LIILGIGMGFFFAPITNLALKKLG-DKTTLGVSLMHYIR 406
gi 490733535 333 GLGIDLRMMLTIGLGGFALGCHLNS-CLTPDSKFAAFILP-QFVRGFSLMFCFIPTNNIALGNMPKEKVGNASGLYNLTR 410
gi 685971521 357 MDRRGPAKIVLVGIMLIAAGLGTFAfGVARQADYLPILPTgLAIMGMGMGCSMMPLSGAAVQTLAPHQIARGSTLISVNQ 436
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507446   407 TLAGSIGTSITTTMWTNRESMHHAQLTESVN-PFNPNAQAMYSQLEGL-----G---------MTQQQASGWIAQQITNQ 471
gi 1169524   411 TLAGSVGTSLTTFMWYNREAVHHTQLTEHIN-PYNPISQSFYHQMNQF-----G---------LSDTQTSAYLAQQITSQ 475
gi 3915990   404 QISGSIGTSLITTIYTNRTTFHYSQIADKTS-TADPNFLHAFQNAVSN-----LmvnmnvsydTAKTYVYSHIYKHASLD 477
gi 499183121 407 FVGGSFGTALATNDIQRYMWENFQRSTEIQNeRILSEFLEKISWLFWI-----G-----------EKKVKALFYQVEQLH 470
gi 490733535 411 NLGGAVGLAIISTILSNDTKIFMQYLSENIS-YTSIIALTRLDSYTELlsgkiL---------NPEQGSYLLLANKLNND 480
gi 685971521 437 QVGGSIGTALMSVLLT--YQFNHSEIIATAK-KVALTPESGAGRGAAV-----D----------PSSLPRQTNFAAQLLH 498
                        490       500
                 ....*....|....*....|....*..
gi 2507446   472 GLIISANEIFWMSAGIFLVLLGLVWFA 498
gi 1169524   476 GFIIGANEIFWLSAMGFLGLLIVIWFA 502
gi 3915990   478 SNVMGINDAFMWATLFCVAGLILSIFL 504
gi 499183121 471 AFSDSFMRTFFVAGLWGLLGSLPIFYL 497
gi 490733535 481 AFVIAINNIFNMIGLLFVFIMLLIPFT 507
gi 685971521 499 DLSHAYAVVFVIATALVVSTLIPAAFL 525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap