Conserved Protein Domain Family
sda_beta

?
TIGR00719: sda_beta 
L-serine dehydratase, iron-sulfur-dependent, beta subunit
This enzyme is also called serine deaminase. This model describes the beta chain of an iron-sulfur-dependent L-serine dehydratase, as in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of beta chains from the homologous region of single chain forms such as found in E. coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 129802
View PSSM: TIGR00719
Aligned: 2 rows
Threshold Bit Score: 338.826
Threshold Setting Gi: 6094257
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6094258   1 MTDYSAFEVMGPIMVGPSSSHTAGACKIANVATSIVSNNYNQVEFQLHGSFAHTFKGHGTDRALVGGILGFEPDDDRIKT 80
gi 6094257   1 MKYRSVFDIIGPVMIGPSSSHTAGAARIGRVARSLFGREPERIIVSFYGSFAETYKGHGTDVAIIGGLLDFDTFDERIKT 80
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6094258  81 SFELAKQAGLNYIFTTTNLGDnYHPNSVKIVFSYPNGEeEYVIGSSIGGGAMKIVNINGIAIEFRGEYSTILLEYPEQRG 160
gi 6094257  81 AIQIAEAKGIDIEFRVEDAVP-VHPNTAKITISDEKGE-LELTGISIGGGKIEITELNGFELRLSGNHPAILVVHNDKFG 158
                      170       180       190       200
               ....*....|....*....|....*....|....*....|....*...
gi 6094258 161 VISYVSSLLTGSEYNIESLNTKKNKLTNIVTLTVEIDKPLTESLKSAI 208
gi 6094257 159 TIAGVANVLAKFSINVGHMEVARKDIGQLALMTIEVDQNIDDHILDEL 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap