Conserved Protein Domain Family
urea_amlyse_rel

?
TIGR00724: urea_amlyse_rel 
biotin-dependent carboxylase uncharacterized domain
Urea amidolyase of Saccharomyces cerevisiae is a 1835 amino acid protein with an amidase domain, a biotin/lipoyl cofactor attachment domain, a carbamoyl-phosphate synthase L chain-like domain, and uncharacterized regions. It has both urea carboxylase and allophanate hydrolase activities. This model models a domain that represents uncharacterized prokaryotic proteins of about 300 amino acids, regions of prokaryotic urea carboxylase and of the urea carboxylase region of yeast urea amidolyase, and regions of other biotin-containing proteins. [Unknown function, General]
Statistics
?
PSSM-Id: 129807
View PSSM: TIGR00724
Aligned: 5 rows
Threshold Bit Score: 447.694
Threshold Setting Gi: 308372844
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 173122    1079 AIEITLPGAHTSIQDYpGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCeTVIAITGG--TA 1156
gi 2495573      1 MLKIIRAGMYTTVQDG-GRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQLTVEFET-DGWFALTGagCE 78
gi 1176146      1 MIDILDVKSRATIQDL-GRFGLRRFGISHCGAMDKLALRAGNILLGNAENVPAIEVPLGGITLQFQQ-DMNFCVTGafYE 78
gi 499187538    3 MIEIISAPSPLLIQDL-GRRGYLKYGVPKSGVMDEVSARLANYLVGNPDDSPLLEFTLVGPTIRFNS-SAVFAVAGd-VD 79
gi 490011178    8 TLEILRSGPLALVEDL-GRAGLAHLGVGRSGAADRRSHTLANRLVANPDDWATVEVTFGGFSARVRGgDVDIAVTGadTD 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 173122    1157 LCTLDGQEIPQHKpVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEe 1236
gi 2495573     79 ARLDDNAVWTGWR-LPMKAGQRLTLKRPQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKSK- 156
gi 1176146     79 MMLDDKPVFAYWR-YQVRAGQILKMARAKIGMYGYLCVQGGFVLPQALNSCSTDLRAQIGGIEGRCLQAGDQLQTAN-D- 155
gi 499187538   80 VYLNDVKIEP-WRsYWAKRGDILRVGMLKSGMYGYIAFAGGIECDRILGSCSTYLRANFG----KPLKPGDKLKLGY--- 151
gi 490011178   87 PTVNGIMVGT-NSiHHVRDGQVISLGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGP---SPLRAGDVLPVGEHT- 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 173122    1237 nksvecLPQNIPQSLIPqiseTKeWRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSngge 1316
gi 2495573    157 ------RDSMEAQGVKQ----LL-WGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTD---- 221
gi 1176146    156 ------HILRSEIGIAP----IP-LRDVIRALPSSEYQAFKRKSQYYWWRNEWTLQSNSDRMGYRFQGQTLELKQP---- 220
gi 499187538  152 ------AILTEKVGKSLpeefIPkYGKEIRVILGPNLENFTRNGIETFLISEYVVTKESDRMGYRLDGPRIEHSDKg--- 222
gi 490011178  162 ------DDYPELDQAPVa--aIEeHLVELRVVPGPRDDWLVDP--DALVHTIWMASNRSDRVGMRLQGRPLQHRWPd--- 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 173122    1317 ggmHPSNTHDYVYSLGAINFTGdEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESSRSLKESQEV 1396
gi 2495573    222 ---RELLSHGLLPGVVQVPHNG-QPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALKARQDQQR 297
gi 1176146    221 ---LEMLSHAIQFGSVQVPPSG-QPIILMADAQTTGGYPKIANVIDADLGALAQVRLGSTIKFEAVSLQEAAKLRRKNEI 296
gi 499187538  223 ---ADIITEAIPLGSIQVPANG-KPIVMLADAQTTGGYAKIAVVSKVDLPAIAQKRPGEKVKFREISVKEAQELLKARER 298
gi 490011178  229 ---RQLPGEGVTRGAIQVPPNG-LPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVRLHWARPRSRLPGQGVTQA 304
                         330
                  ....*....|....
gi 173122    1397 AIKSLDGTKLRRlD 1410
gi 2495573    298 YFEQLAWRLHNE-N 310
gi 1176146    297 YLDQIRRIVDEK-N 309
gi 499187538  299 TMKALRKALTAEgn 312
gi 490011178  305 W------------- 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap