Conserved Protein Domain Family
ISP4_OPT

?
TIGR00727: ISP4_OPT 
small oligopeptide transporter, OPT family
This model represents a family of transporters of small oligopeptides, demonstrated experimentally in three different species of yeast. A set of related proteins from the plant Arabidopsis thaliana forms an outgroup to the yeast set by neighbor joining analysis but is remarkably well conserved and is predicted here to have equivalent function. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129810
View PSSM: TIGR00727
Aligned: 3 rows
Threshold Bit Score: 1032.13
Threshold Setting Gi: 786296
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543   67 EEDSPYPEVRAAVPPTDDPSMPCNTIRMWTIGLIYSTVGAAVNMFFSLRNPTVTLSVLISELLAYPALQIWDLIFPDreF 146
gi 2367386  67 EDDSPYPEVRAAVPSTDDPTLPQNTIRAWVIGLILTTVGCGMNMLFSFHSPSFAITTFVTSILAWPIGNFWAWIVPD--W 144
gi 786296  141 KFHSPYQEVRAVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQMFLYICGKAWAKTIPCwtI 220
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  147 RIGRLKFNf-kPGPFNVKEHALIVVMSSVSFGN--AYSTDIILAQRVHYKQRFGFGYEICLTLATQLIGYGLAGLSRRLL 223
gi 2367386 145 KIFGASLN---PGPFNVKEHTIITIMANVSFGTgaAYATDILLAQNMFYKSNFGWGYNLLLIWSTQCIGFAFGGVMRRFV 221
gi 786296  221 TIRGRKYGiniDKPWTQKEQMFSTLLYAICQGA--FYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFV 298
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  224 VRPASMLWPVNLVQCTLIKTLHRKdlRNAVANGWRISPFRFFLYVFIASFIWNWFPSYIFQALSLFAWVTWIRPNSPTVN 303
gi 2367386 222 VDSPGAIWPSNLVTATFLTNMHIN--ENHTANGWKISRLAFFVIVFVASFVWYWFPGYIFQALSYFSWITWIKPNNVIIN 299
gi 786296  299 VYPARALWPTVMPTIAINKALLGK--EKHESG---MSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNINLA 373
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  304 QIFGESTGISILP--MTFDWNQISAYILSPLMAPADALMNILLGVILFFWIVTPALNFTNTWYGDYLPISSSGIIDHFGN 381
gi 2367386 300 QVFGSSSGLGMIPnnIALDWNQIAGYIGSPLIPPASVIATIFGSIVLIFWIVVPAIHYSNTWYSQYLPISSTGSFDRFQQ 379
gi 786296  374 NITGGVTGLGINPi-SSFDWNVIS--FNSPLVYPFWSYLTQYLGCILAALIVI-AVYYSNYMSCQYLPIFTNSLYTNTGH 449
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  382 SYNVTRILT-KDATFDLDAYQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEIYDRLRD---------------- 444
gi 2367386 380 TYNVSKIIDhKTLSFNEAEYKKYSPLFLSTTFAISYGLSFASILATITHTICFHGRDLIASLKA---------------- 443
gi 786296  450 SFKVTEVLD-SDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFIVHSKLLFNAFKDwalnlwamrklkswvt 528
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  445 ---------PPAPDIHEKLMKAYDEVPFYWYLSVFLAFFGMMMGTIYGWKTETPWWVIIVGVIFSAVWFIPIGIVQAITN 515
gi 2367386 444 ---------KEKPDVHNRLMKAYKPVPEWWYLVVFLVFFGMSIATVRAWPTEMPVWGLVFALIIAIIFLLPVAIIYAKTN 514
gi 786296  529 mfksdyralDDYDDPHSNAMKNYKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPTTILQATTG 608
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  516 IQLGLNVFTEFIVGYMYPGRPLAMMIFKTVGYITMTQGLAFAADLKFGHYMKLPPRIMFYTQMIATIWSCFVQIGVLDWA 595
gi 2367386 515 IAVGLNVVTEFIVGYVLGGRPLCMMLFKTFGYITNNQAVTFVQDMKLGHYMKIDPRTLFWAQFAATIWGSLVQIAVLEWA 594
gi 786296  609 YSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCVIVFIQIFVNLGVLNWQ 688
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218543  596 LGNIDNVCQADQPDNYTCPNATVFFNSSVIWGVIGPKRMFSGKNTYTGLQYFWLAGVLGTILFWALWKKWPQKWWGQLNG 675
gi 2367386 595 YGAIDNLCAADQKNHYTCPNGKVFFNASIIWGVIGPQRQFSHGQIYYGLLFFFIIGAVTPVINWLILKKWPNSPVKYLHW 674
gi 786296  689 ISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGAIGPKRIFN--YIYPIFKWCWLIGACIGIFFG-VWKRWGKFYPRYFD- 764
                      650       660       670       680       690       700       710
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218543  676 PLIFGGTGYIPPATPVNYLAWSG---IGLFFNYYLKKIFADWWQKYNFTLSA-LDTGTQLSVIILFFCLQLPMVNF 747
gi 2367386 675 PVFFSGTGYIPPATPYNYTSYCA---VGLFFGWWIKKKWFHWWSKYNYSLSAgLDIGLAWCSLIIFLCLSLTNTDF 747
gi 786296  765 PMLFVG-GMLNMSPPYNLMYYTSgmiVSYISQYYMKRHHLNLWEKYNYVLSAgFSTGLVLSAIIIFFAVQYKDTAF 839
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap