1T35


Conserved Protein Domain Family
TIGR00730

?
TIGR00730: TIGR00730 
Click on image for an interactive view with Cn3D
TIGR00730 family protein
This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129813
View PSSM: TIGR00730
Aligned: 5 rows
Threshold Bit Score: 270.539
Threshold Setting Gi: 6458157
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T35_A         2 KTICVFAGSNPGGNEAYKRKAAELGVYXAEQGIGLVYGGSrVGLXGTIADAIXENGGT---------------------- 59
gi 6458157    54 PLVTVYGSARTALTDRYYGLAQTLGRELVGAGFGVVTGGG-PGIMQAANQGAYEAGGV---------------------- 110
gi 504719466  14 KTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSrVGLMGTIADAIMENGGT---------------------- 71
gi 489995734  11 WTVAVYCAASP-THAELLELAAEVGAAIAGRGWTLVWGGGhVSAMGAVASAARACGGW---------------------- 67
gi 1352984    19 KSVCVYCGSSFGAKALYSESAEELGALFHKLGWKLVYGGGtTGLMGKIARSTMGPDLSgqvhgiipnalvskertdedke 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T35_A        60 ----AIGVXpSGLFSGEVVHQNLTELIEVNGXHERKAKXSELADGFISXPGGFGTYEELFEVLCWAQIGIHQKPIGLYNV 135
gi 6458157   111 ----SVGLN-IVLPHEQRHNPYQTLSLEFEYFHARKVMLARYAHAFVAFPGGFGTLDEMMEILTLVQTRKMRPVPIYFVG 185
gi 504719466  72 ----AIGVMpSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCWAQIGIHQKPIGLYNV 147
gi 489995734  68 ----TVGVIpKMLVYRELADHDADELIVTDTMWERKQIMEDRSDAFIVLPGGVGTLDELFDAWTDGYLGTHDKPIVMVDP 143
gi 1352984    99 dvnkALLESvENHKGATPISEEYGETTIVPDMHTRKRMMANLSDAFVAMPGGYGTFEEIMECITWSQLGIHNKPIILFNI 178
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
1T35_A       136 NGYFEPXXKXVK-YSIQEGFSNESHLKLIHSSSRPDELIEQXQNY 179
gi 6458157   186 EAHWRGLVEWFRtSLVENGAIAADDLKLFKLVDDVSQIPADVRAY 230
gi 504719466 148 NGYFEPMMKMVK-YSIQEGFSNESHLKLIHSSSRPDELIEQMQNY 191
gi 489995734 144 WGHFDGLRAWLN-GLLDTGYVSPTAMERLVVVDNVKDALRACAPS 187
gi 1352984   179 DGFYDKLLEFLK-HSIQERFISVKNGEIIQVASTPQEVVDKIEKY 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap