Conserved Protein Domain Family
nifR3_yhdG

?
TIGR00737: nifR3_yhdG 
putative TIM-barrel protein, nifR3 family
This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General]
Statistics
?
PSSM-Id: 129820
View PSSM: TIGR00737
Aligned: 9 rows
Threshold Bit Score: 473.004
Threshold Setting Gi: 6136586
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647988    15 IGPIELASPVVLAPMAGVTNVAFRALCRQLEqskvgtvSGLYVCEMVTARALIERH-PVTMHMTTFSADESPRSLQLYTV 93
gi 586896      4 IGDIQLKNRVVLAPMAGVCNSAFRLTVKEFG-------AGLVCAEMVSDKAILYNN-ARTMGMLYIDEREKPLSLQIFGG 75
gi 2833467    35 IGSLTLHSRVLQSPLSGVTDLVFRRLVRRYAp------QAMLYTEMVSATEIHHLR--TLPQVMEIDPRENPISIQLFDC 106
gi 134047751   4 IGNIELSSNVILAPMSDVTDLEFRKLVKRFG-------AGLVVSEMIASRAMIMKSrQSMQKCAIMHDDPTSACVQLAGC 76
gi 586643      3 IGQYQLRNRLIAAPMAGITDRPFRTLCYEMG-------AGLTVSEMMSSNPQVWES-DKSRLRMVHIDEPGIRTVQIAGS 74
gi 1176212     3 IGSYQLRNRVLLAPMAGITDQPFRRLCAYYG-------AGLTFSEMMSTNPQVWHT-EKSKLRLAHSEDLGLNAVQIAGS 74
gi 6136586    12 IGPLSLKGNVFFAPVAGYSDSAFRSIAIEWE-------ASFTYTEMVSSEAMVRDS-LNTKRLIRRASNETHYAIQIFGS 83
gi 499185865   7 IKNILLRSSIVYAPLAGFSDYPYRCMSALYQ-------PGLMFCEMVKVEGILYAP-ERTSKLLDYNENMRPIGAQLCGS 78
gi 497557830   7 IKNLPLKSPVVYAPLAGFSDFPYRRMSAEYR-------PALMFCEMVKMEGLHYCP-QRTLRLLDFAESMRPIGGQLCGS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647988    94 DPDTTYAAARmIAGEGLADHIDMNFGCPVPKVTKRGGGAALPFKRRLFGQIVAAAVRATEgt--dIPVTVKFRIGIDDAH 171
gi 586896     76 KKETLVEAAKfVDQNTTADIIDINMGCPVPKITKCDAGAKWLLDPDKIYEMVSAVVDAVN-----KPVTVKMRMGWDEDH 150
gi 2833467   107 RPDFMAEAAQ-KAVAQGAQSVDINMGCPVNKITKKGGGSSLLRQPAVAEAIVKTVVAAVD-----VPVTVKTRLGWDDGE 180
gi 134047751  77 EPDVIAEAAK-MNEDMGAKIIDLNFGCPAKKVVGGYAGSALMRDEQLAAKIFEATVKAVK-----IPVTVKMRIGWDDNT 150
gi 586643     75 DPKEMADAAR-INVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVD-----VPVTLKIRTGWAPEH 148
gi 1176212    75 DPLEMAQAAA-INVEYGAQIIDINMGCPAKKVNRKLAGSALLQFPDLVEKILREVVSAVN-----VPVTLKIRTGWDKSN 148
gi 6136586    84 NPAVMAETAKlIVDSAQPSCIDINAGCPMPKITKTGAGAALTREPTRLYEVVKAVADAVYaqdarIPVTVKIRAGWEEAH 163
gi 499185865  79 NPETSGEAAK-ILEGLGFDLIDLNCGCPTDKITKDGSGSGLLKTPELIGRILDKIINSVS-----IPVTVKIRSGWDMEH 152
gi 497557830  79 RPDLAGESAK-ILEGLGFDLIDLNCGCPTDRITKDGSGSGMLKTSELIGKVVEKMVEVVS-----VPVTVKIRSGWDFDH 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647988   172 HTHLDAGRIAEAEGAAAVALHARTAAQRYSGTADWEQIARLKQHVRt---IPVLGNGDIYDAGDALAMMSTTGCDGVVIG 248
gi 586896    151 IFAVKNAQAVERAGGKAVALHGRTRVQMYEGTANWDIIKEVKQSVS----IPVIGNGDVKTPQDAKRMLDETGVDGVMIG 226
gi 2833467   181 INIVEFAQRLQDAGAQMLTLHGRTRAQGYNGRARWQWIAKVKQALT----IPVIANGDIFSVEAAIACLEETGADGVMCS 256
gi 134047751 151 RNAPTLAKIAANSGVQMVTVHGRTRCQFYSGNANWDFIRTVKEAVK----IPVIANGDITNFAKAKEALQRSGADGIMVG 226
gi 586643    149 RNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVS----IPVIANGDITDPLKARAVLDYTGADALMIG 224
gi 1176212   149 RNCVQIGKIAEQCGIQALTVHGRTRACLFEGEAEYDNIKAVKQAIA----IPVIANGDIDSARKAKFVLNYTGADAIMIG 224
gi 6136586   164 LTWKEAARAAVDAGAQALALHPRTCAQCYAGEANWDIIADLVQCARgwgeVPVFGSGDLHAPEDARAMLEHTACAGVMFA 243
gi 499185865 153 INVEDTVRIIRDAGASAVFVHGRTRAQGYHGPSKQEYISRAKAAAGk--eFPVFGNGDIFSPEAAQAML-TTGCDGVLVA 229
gi 497557830 153 INVEETVRIIKESGASAVFVHGRTRSQGYQGPSNLEFISRAKQAAGn--dFPVFGNGDVFSPEAAKTMLETTHCDGVLVA 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647988   249 RGCLGRPWLFAELSAAFTGSPAPTPPTLGEVADIIRRHGTLLAAHFG-EDKGMRDIRKHIAWYLHGFPAGSALRRALAMV 327
gi 586896    227 RAALGNPWMIYRTVQYLETGKLKEEPQVREKMAVCKLHLDRLIDLKG-ENVAVREMRKHAAWYLKGVKGNANVRNEINHC 305
gi 2833467   257 RGSLGYPFLVGEIEHFFKTGEKRKAPTVAEKLTCAQEHLQMLWEYKG--QRGLFQARKHLAWYCKDFPGAAALREQLFQI 334
gi 134047751 227 RGVYGKPWLISQIAYYLKTGKEKPAPSIAEQLDIITKHYDAIIDYYG-KSVGVPIARKHIIWYSNGLPSSAEFRCTVNLM 305
gi 586643    225 RAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYG-PAKGYRIARKHVSWYLQEHAPNDQFRRTFNAI 303
gi 1176212   225 RAALGNPWLFQAVENLIEHNSISQMPSLKEKCGQILRHIQELHQFYG-EQKGYRIARKHVAWYLQGIQPDSVFKQTFNAI 303
gi 6136586   244 RGAMGNPFIFRQTRQLLTEGYYT-PVTFEQKLRAAWRELHLLAQDVG-ESSACKQMRKRFVSYAKGERGKTQWCQRAVHA 321
gi 499185865 230 RGTLGAPWIGKQIQDYLTTGSYEK-IPFIKRKAAFLEHMRLVEDYYQsETKFLSETRKLCGHYLISAAKVRFLRSSLAKA 308
gi 497557830 231 RGTMGAPWIGKQIEDYLTTGTYS-SPSFSTRKQAFVQHLQWIEEYYQsEEKLLTDTRKLCGHYLILSPKVRSLRANLAKA 309
                        330
                 ....*....|....*...
gi 6647988   328 KTFDELDCLLDRLDGTVP 345
gi 586896    306 ETREEFVQLLDAFTVEVE 323
gi 2833467   335 NSVQEGKDLLDQAISTAK 352
gi 134047751 306 KDPIAVKEKIAEFYMSVM 323
gi 586643    304 EDASEQLEALEAYFENFA 321
gi 1176212   304 SDPKEQLIVLEDFFNLIL 321
gi 6136586   322 SSFADFAAVIRDACPCIG 339
gi 499185865 309 TSYQEVYQLVNDYEEADD 326
gi 497557830 310 SSSQEVYQLIDGFeepte 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap