1Q18


Conserved Protein Domain Family
glk

?
TIGR00749: glk 
Click on image for an interactive view with Cn3D
glucokinase, proteobacterial type
This model represents glucokinase of E. coli and close homologs, mostly from other proteobacteria, presumed to have equivalent function. This glucokinase is more closely related to a number of uncharacterized paralogs than to the glucokinase glcK (fromerly yqgR) of Bacillus subtilis and its closest homologs, so the two sets are represented by separate models. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 129832
View PSSM: TIGR00749
Aligned: 4 rows
Threshold Bit Score: 506.728
Threshold Setting Gi: 20138118
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q18_A       17 LVGDVGGTNARLALC---DIASGEISQA----KTYSGLDYPSLEAVIRVYLEEHKVEVKD------GCIAIACPITGDWV 83
gi 3183526    6 LVGDVGGTNARLALC---DIASGEISQA----KTYSGLDYPSLEAVIRVYLEEHKVEVKD------GCIAIACPITGDWV 72
gi 20138111  10 LLADIGGTNARFGL----EVAPRQIECI----EVLRCEDFESLSDAVRFYLSKCKESLKLhp--iyGSFAVATPIMGDFV 79
gi 20138118   9 LAGDIGGTKTILALVtinESSPGLARPVtlfeQTYSSPAFPDLVPMVQQFRQEAAFVLGNpisvakACFAIAGPVIDNTC 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q18_A       84 AXTNHTWAFSIAEXKKNLGFSHLEIINDFTAVSXAIPXLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVH-VDKRW 162
gi 3183526   73 AMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVH-VDKRW 151
gi 20138111  80 QMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQENDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQnSDGSL 159
gi 20138118  89 RLTNLDWHLSGDRLAQELAIAQVDLINDFAAVGYGILGLGSEDLTVLQAAPVDPSGAIAILGAGTGLGQCYVIPqGQGRY 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q18_A      163 VSLPGEGGHVDFAPNSEEEAIILEILRAEI--GHVSAERVLSGPGLVNLYRAIVKAD--------NRLP-ENLKPKD--- 228
gi 3183526  152 VSLPGEGGHVDFAPNSEEEAIILEILRAEI--GHVSAERVLSGPGLVNLYRAIVKAD--------NRLP-ENLKPKD--- 217
gi 20138111 160 KVLPGEGGHVSFAPFDDLEILVWQYARSKF--NHVSAERFLSGSGLVLIYEALSKRKgle---kvAKLSkAELTPQI--- 231
gi 20138118 169 RVFASEGAHGDFAPRSPLEWQLLEYLKKKYslGRISIERVVSGMGIAMIYEFLRHQYperesaqfSKLYqTWNREKDqet 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q18_A      229 --------ITERALADSCTDCRRALSLFCVIXGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKE 300
gi 3183526  218 --------ITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKE 289
gi 20138111 232 --------ISECALNGDYPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGRMGA 303
gi 20138118 249 ktvdlaaaVSQAALEGTDVLADQAMELFLGAYGAEAGNLALKLLPRGGLYVAGGIAPKIIPLLEKGSFMQGFSDKGRMQS 328
                       330       340
                ....*....|....*....|.
1Q18_A      301 YVHDIPVYLIVHDNPGLLGSG 321
gi 3183526  290 YVHDIPVYLIVHDNPGLLGSG 310
gi 20138111 304 FLASIPVHVVLKKTPGLDGAG 324
gi 20138118 329 LMGTIPVQVVLNAKVGLIGAA 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap