Conserved Protein Domain Family
menA

?
TIGR00751: menA 
1,4-dihydroxy-2-naphthoate octaprenyltransferase
This membrane-associated enzyme converts 1,4-dihydroxy-2-naphthoic acid (DHNA) to demethylmenaquinone, a step in menaquinone biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 129834
View PSSM: TIGR00751
Aligned: 3 rows
Threshold Bit Score: 344.941
Threshold Setting Gi: 3183075
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170914  19 RPKTLPLALASIFTGSALGYWANpqGFNGLVMVLCLLTTILLQVLSNFANDYGDHQKGSDTEERIGPLRGIQKGAISAKE 98
gi 418508   17 RPKTLPLAFAAIIVGTALAWWQG--HFDPLVALLALITAGLLQILSNLANDYGDAVKGSDKPDRIGPLRGMQKGVITQQE 94
gi 3183075  12 RPRTLPNAIAPVVAGTGAAAWLH--AAVWWKALLALAVAVALVIGVNYANDYSDGIRGTD-DDRVGPVRLVGSRLATPRS 88
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170914  99 LKWGLILMVMASFLSGSFLIGIAYENLSDLFAFAGLGILAIVAAITYTVGVKPYGYMGLGDISVLVFFGLLGVGGTYYLQ 178
gi 418508   95 MKRALIITVVLICLSGLALVAVACHTLADFVGFLILGGLSIIAAITYTVGNRPYGYIGLGDISVLVFFGWLSVMGSWYLQ 174
gi 3183075  89 VLTAAMTSLALGALAGLVLALLSAP------WLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQ 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170914 179 THSIDSHIILPAIGSGLLASAVLNINNLRDIEQDAKAGKNTLAVRLGAYKGRVYHCILLSVAALCYLAFAVATAISWTNY 258
gi 418508  175 AHTLIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGEVNARRYHACLLMGSLVCLALFNLFSLHSLWGW 254
gi 3183075 163 ALRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLAVAGVLTFVLMLATP---WCV 239
                      250       260       270       280
               ....*....|....*....|....*....|....*....|....*.
gi 1170914 259 LFVLAMPLLAKHAIFVYCSQQPSELRPILAQMSMISLLINILFSLG 304
gi 418508  255 LFLLAAPLLVKQARYVMREMDPVAMRPMLERTVKGALLTNLLFVLG 300
gi 3183075 240 VGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALAVAGA 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap