Conserved Protein Domain Family
DcuC

?
TIGR00771: DcuC 
c4-dicarboxylate anaerobic carrier family protein
These proteins are members of the C4-dicarboxylate Uptake C (DcuC) Family (TC 2.A.61). The only functionally characterized member of this family is the anaerobic C4-dicarboxylate transporter (DcuC) of Escherichia coli. DcuC has 12 GES predicted transmembrane regions, is induced only under anaerobic conditions, and is not repressed by glucose. It may therefore function as a succinate efflux system during anaerobic glucose fermentation. However, when overexpressed, it can replace either DcuA or DcuB in catalyzing fumarate-succinate exchange and fumarate uptake. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129854
View PSSM: TIGR00771
Aligned: 3 rows
Threshold Bit Score: 321.466
Threshold Setting Gi: 1175266
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176202  55 GYLIVDIYNEILRMLSNRIAGLGLSIMAVGGYARYMERIGASRAMVSLLSRPLKLIRSPYIILSATYVIGQIMAQFITSA 134
gi 2498297  58 GYSATDIVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVKLASKPLQYINSPYLLMIAAYFVACLMSLAVSSA 137
gi 1175266     --------------------------------------------------------------------------------
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176202 135 SGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIFAAQVAGMKIATYFFHYQLPVASCVIISVAISHFF 214
gi 2498297 138 TGLGVLLMATLFPVMVNVGISRGAAAAICASPAAIILAPTSGDVVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFF 217
gi 1175266   1 ----------------------------MMSPGSSHSAMISEMSGLTITQVNLSHAPYN---MIAGAIGAVVLTILALVF 49
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176202 215 VQRAFDKKDkNINHEQAEQKALDNVPPLYYAILPVMPLILMLgsLFLAHVGlmqSELHLVVVMLLSLTVTMFVEFFRKHN 294
gi 2498297 218 WQRYLDKKE-HISHEMLDVSEITTTAPAFYAILPFTPIIGVL--IFDGKWG---PQLHIITILVICMLIASILEFLRSFN 291
gi 1175266  50 KDYGEQHRQaYLAEQKESEIKVIEGVNVLYALAPLIPLVILV----IGGTSlqqVPGLEWTKMGVPQAMLIGAIYGIIVT 125
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176202 295 LRETMDDVQAFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALVIAICAIVMGSGNAP 374
gi 2498297 292 TQKVFSGLEVAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIATSFGSASIILMLVLVILTMLAAVTTGSGNAP 371
gi 1175266 126 RISPVKITEEFFNGMGNSYANVLGIIIAASVFVAGLKSTGAVDAAISFLKES---NEFVRWGATIGPFLMGLITGSGDAA 202
                      330       340       350       360       370       380       390
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176202 375 FMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVTSGIAGVSPFAVVKRTAIPMAVGFV 444
gi 2498297 372 FYAFVEMIPKLAHSSGINPAYLTIPMLQASNLGRTLSPVSGVVVAVAGMAKISPFEVVKRTSVPVLVGLV 441
gi 1175266 203 AIAFNTAVTPHAVELGYTHVNLGMAAAIAGAIGRTASPIAGVTIVCAGLAMVSPVEMVKRTAPGMILAVL 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap