Conserved Protein Domain Family
NhaD

?
TIGR00775: NhaD 
Na+/H+ antiporter, NhaD family
These proteins are members of the NhaD Na+:H+ Antiporter (NhaD) Family (TC 2.A.62). A single member of the NhaD family has been characterized. This protein is the NhaD protein of Vibrio parahaemolyticus which has 12 GES predicted transmembrane regions. It has been shown to catalyze Na+/H+ antiport, but Li+ can also be a substrate. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129857
View PSSM: TIGR00775
Aligned: 3 rows
Threshold Bit Score: 518.292
Threshold Setting Gi: 3123728
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4377346   1 MLKLQLCALFLFGYLAIVFEHIVRVNKSAIALAMGGLMWLVCFSHIPMADHMILVEEIADMSQVIFFLFSAMAIVELIDA 80
gi 3329330   1 MLKFQLCLLFLFGYLTIVFEHIVRVNKSAVSLAMGGLMWLVCFSHIPHIDHVMMFEEIADMAQVIFFLFAAMAIVELIDA 80
gi 3123728   1 ----------------MRKSKPVLLAAGLIWILIG---YTFAQHHQQDVAKAALEHNLLEYAELLLFLLVAMTYINAMEE 61
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4377346  81 HKGFSVIVKFCRIQSR--TLLLWALIGLSFFLSAALDNLTSIIIIISILKRLVKAREDRLLLGAI-CVIAVNAGGAWTPL 157
gi 3329330  81 HRGFSIVVRCCNVESR--SVLLWVLLTLSFFLSAALDNLTSIIIIISILKRLVKAREDRLLLGAL-CVIGVNAGGAWTPL 157
gi 3123728  62 RKLFDALQAWMVGKGFgfKKLFWLTGFLAFVISPIADNLTTALLMCAVVMKVSGDNPRFVNLACInIVIAANAGGAFSPF 141
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4377346 158 GDVTTTMLWINNKITSWGIIRALFVPSLVCVLVAGFCGQFFLRKRGSTLIAKDVELQSAPPKSLWIIFIGLGSLLMVPVW 237
gi 3329330 158 GDVTTTMLWINDKISTSGIITTLFLPSVVCVVIAGICGQLLLKKRRCSGLSEDLDREPALPKSNLIACVGFGSLLMVPMW 237
gi 3123728 142 GDITTLMVWQAGHVRFS-EFMPLFVPSLINYVVPAFLMALFVPNTKPNTIHEHVELKRG---ARRIVLLFVLTIATAVSF 217
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4377346 238 KACLGLPPFMGALLGLGLVWLTSDWI-----HS-------------PHGEDRYHLRVP----HILTKIDISSITFFIGIL 295
gi 3329330 238 KAVLGVPPFMGALLGLGLVWLVSDWI-----HS-------------PHGEGRNHLRMP----HILTRIDISSVTFFIGIL 295
gi 3123728 218 HAVLHFPPVVGMMMGLAYLQFFGYFLrktlkHSlakkaamaiangdDHALKRLGSVVPfdvfHRVSRAEWDTLLFFYGVV 297
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4377346 296 LAVNALSFANLLTDFSLWMDKIFSRNVVAIVIGLLSSVLDNVPLVAATMGMYTLPLDDTLWKLIAYAAGTGGSILIIGSA 375
gi 3329330 296 LAVNALTYSHVLRDLSVSMDALFSRNTLAVLLGLVSSVLDNVPLVAATIGMYDLPMNDPLWKLIAYTAGTGGSILIIGSA 375
gi 3123728 298 MCVGGLSLLGYLELVSNVMYTQWNPVWANVMVGVLSAIVDNIPVMFAVLTMDPS-MSTGNWLLVTLTAGVGGSLLSIGSA 376
                      410       420       430       440
               ....*....|....*....|....*....|....*....|....*.
gi 4377346 376 AGVAFMGLEKVDFLWYFKRISWIALASYFGGLFSYFVLES-LNFFI 420
gi 3329330 376 AGVAYMGMEKVSFGWYVKHASWIALASYFGGLAVYFLMENcVSLFV 421
gi 3123728 377 AGVALMGAARGQYT-FFGHLKWTPVIALGYAPVLPLICG------- 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap