Conserved Protein Domain Family
ccoN

?
TIGR00780: ccoN 
cytochrome c oxidase, cbb3-type, subunit I
This model represents the largest subunit, I, of the ccb3-type cytochrome c oxidase, with two protohemes and copper. It shows strong homology to subunits of other types of cytochrome oxidases. Species with this type, all from the Proteobacteria so far, include Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Rhodobacter sphaeroides, Rhizobium leguminosarum, and others. Gene symbols ccoN and fixN are synonymous. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129862
View PSSM: TIGR00780
Aligned: 3 rows
Threshold Bit Score: 705.862
Threshold Setting Gi: 15644773
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878    64 PETQYmdDVVRAGVIATAFWGVVGFLVGVVIAFQLAFPALNLSDITMgYTNFGKLRPLHTSAVIFAFGGNGLIATSFYVV 143
gi 488141387   8 QTYNY--KVVRQFAIMTVVWGIVGMLVGVIVAAQLFAPALDLSNIGP-WFHFGRLRPLHTNAVIFAFGGCGLIGTSYYVV 84
gi 447080439   7 LSYDY--SISKLFLYAMVGFGIVGMLIGIVLAFELSFPNLNY--IAGeYGIFGRLRPLHTNAVIYGFTLGGIWASWYYIG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878   144 QR----TSAARLWGGNAAWFVFWGYQLFIVLAATGYILGATQSKEYAEPEWYVDWWLTVVWVVYLAVFLGTILKRKEPHI 219
gi 488141387  85 QR----TCNTRLFGGWLPAFTFWGWQAVIVAAVVSFPMGWTQGKEYAELEWPIDILITLVWVAYAIVFFGTIAKRKIKHI 160
gi 447080439  83 QRvlkiTYHQHPFLKIVGLLHFWLWIILLILGVISLFAGLTQSKEYAELMWPLDIIVVVAWVLWGVNMFGSMSVRRENTI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878   220 YVANWFYLSFIVTIAMLHIVNNLAIPVSLFg-----sKSVQLFSGVQDAMTQWWYGHNAVGFFLTAGFLGMMYYFIPKQA 294
gi 488141387 161 YVANWFYGGFILAVALLHIVNNISIPAGLM-------KSYPVYSGAIDAMVQWWYGHNAVGFFLTAGFLGMMYYFVPKQA 233
gi 447080439 163 YVSLWYYIATYVGIAVMYIFNNLSVPTYFVadmgsvwHSISMYSGSNDALIQWWWGHNAVAFVFTSGVIGTIYYFLPKES 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878   295 ERPVYSYKLSIIHFWALIFLYIWAGPHHLHYTALPDWASTLGMVFSIILWMPSWGGMINGLMTLSGAWDKLRTDPIIRMM 374
gi 488141387 234 ARPVYSYRLSVVHFWALIFTYMWAGPHHLHYTALPDWTQSLGMVLSLILFAPSWGGMINGIMTLSGAWDKLRTDPILKFL 313
gi 447080439 243 GQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTVPDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQLKESPLIKFL 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878   375 VVAVGFYGMATFEGPMMSIKAVNFVSHYTDWTIGHVHSGALGWNGMITFGALYYLVPRLWGRERLYSTGLVSWHFWLATI 454
gi 488141387 314 IVSLSFYGMSTFEGPMMSIKTVNALSHYTDWTVAHVHAGALGWVGFVTIGSVYYMIPRLFGKEQMHSTKLVEAHFWIATI 393
gi 447080439 323 VLASTFYMLSTLEGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTPRLFKRE-IYSGRLVDFQFWIMTL 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1002878   455 GLVLYAASMWVSGIMEGLMWREVDAQGFLVNAFADTVAAKFPMNVVRALGGVLYLGGALIMCYNLWATVAKQPKTQSTAA 534
gi 488141387 394 GVVLYIAAMWIAGVMQGLMWSSLNDDGTLTYSFVESVKRTMPYYVIRFAGGLLYLSGMCIMAYNVYRTAIGGKAVDAEIP 473
gi 447080439 402 GIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKVLIPYYNIRGVGGLMYFIGFIIFAYNIFMTITAGKKLEREPN 481

                 ....*
gi 1002878   535 AVPAE 539
gi 488141387 474 AVSQT 478
gi 447080439 482 YATPM 486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap