Conserved Protein Domain Family
ccoO

?
TIGR00781: ccoO 
cytochrome c oxidase, cbb3-type, subunit II
This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups). [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129863
View PSSM: TIGR00781
Aligned: 4 rows
Threshold Bit Score: 364.235
Threshold Setting Gi: 15677570
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2338740     7 HHVLEKNATLLLIFAFLVVTIGGIVEIAPLFYLENTIEKVEGMRPYTPLELTGRDIYIREGCYVCHSQMIRPMRDEVERY 86
gi 2114419     8 HQILEKNATLLLVGSLLVVSIGGIVEIAPLFYLQNTIEKVEGIRPYTPLELAGRNIYIREGCYLCHSQMIRPFRDEVERY 87
gi 446412933   2 FSFLEKNPFFFTLAFIFVFAIAGLVEILPNFFKS--ARPIEGLRPYTVLETAGRQIYIQEGCYHCHSQLIRPFQAEVDRY 79
gi 488141388   4 QQLAEEKIGVLIVFTLLVVSVGLLIEVVPLAFTKAATQPAPGVKPYNALQVAGRDIYIREGCYNCHSQMIRPFRAETERY 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2338740    87 GHYSLAAESMYDHPFQWGSKRTGPDLARVGGRYSDAWHVEHLSNPQSVVPESVMPSYSYLANVPLDSTWIEDRVSTDALV 166
gi 2114419    88 GHYSLAAESMYDHPFQWGSKRTGPDLARVGARYSNEWHVQHLADPRAVVPESIMPSYAFLKEQRVTVKDVGMDLKANEDV 167
gi 446412933  80 GAYSLSGEYAYDRPFLWGSKRIGPDLHRVGDYRTTDWHEKHMFDPKSVVPHSIMPAYKHLFTKKSDFDTAYAEALTQKKV 159
gi 488141388  84 GHYSVAGESVYDHPFQWGSKRTGPDLARVGGRYSDEWHRIHLLNPRDVVPESNMPAFPWLARNKVDVDATVANMKALRKV 163
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2338740   167 -GVPYSAEMIAAAKADFVAQADPNADSATLVANYgEKVNIRNFDGKPg-LTEMDALVAYLQVLGTMVDFSTFQPV 239
gi 2114419   168 -GVPYDDDMLANAEADMKAQADPNADTTALLARY-PKAKTGDFDGDPaaLTEMDALVSYLQMLGTLVDFSTYDDA 240
gi 446412933 160 fGVPYDTENGVKLGSVEEAKKAYLEEAKKITADMkDKRVLEAIERGE--VLEIVALIAYLNSLGNSRINANQNAK 232
gi 488141388 164 -GTPYSDEEIAKA-PEALANK-----------------------------SELDAVVAYLQGLGLALKNVR---- 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap