Conserved Protein Domain Family
ccs

?
TIGR00783: ccs 
citrate carrier protein, CCS family
These proteins are members of the Citrate:Cation Symporter (CCS) Family (TC 2.A.24). These proteins have 12 GES predicted transmembrane regions. Most members of the CCS family catalyze citrate uptake with either Na+ or H+ as the cotransported cation. However, one member is specific for L-malate and probably functions by a proton symport mechanism. [Unclassified, Role category not yet assigned]
Statistics
?
PSSM-Id: 129865
View PSSM: TIGR00783
Aligned: 8 rows
Threshold Bit Score: 366.703
Threshold Setting Gi: 623057
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399259   91 AYFVYAGIFTQKEIDAISNVMDK-SNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVG-ASLFGIVIGLCFGI 168
gi 399257   91 AYFVYAGIFTQKEIDAISNVMDK-SNFLNLFIAVLITGAILSVNRRLLLKSLLGYIPTILMGIVG-ASIFGIAIGLVFGI 168
gi 1146122  91 SIMVFFNLLNQNVLDSTDILMKQ-ANFLYFYIACLVCGSILGMNRKILVQGLMRMIVPMALGMIL-AMGVGTLVGTLLGL 168
gi 1934815  98 SFLVFYNVLNSTSLDAVTNLMKT-SNFLYFYIACLVVGSILGMNRIVLIQGFIRMFVPLVAGTIA-AVAAGILVGFIFGY 175
gi 623057   95 AILVATNVMPKYVVTTASGFING-MDFLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALtAVVIG-IVGVIIGV 172
gi 1079560  95 AILVATNVMPKYVVTTASGFING-MDFLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALtAVVIG-IVGVIIGV 172
gi 2130998  77 TLLSFFHIVPSNVIGAVSNFMGGkFGFLDFYIAALICGSILGMNRNLLVKASKKFIPIALITMVIgFFSVG-LVGMLIGN 155
gi 1783249 100 SAVVYYHLLPNDIVKSTTEFTEN-SNFLYLFIAGIVVGSILGMKRETLVKAFMKIFIPLIVGSVT-AAIVGLAVGTLLGL 177
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399259  169 PVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRS-REEYYSTAIAILTIANIFAIIFAALLDMIGKKYTWLSGEGELV 247
gi 399257  169 PVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRS-REEYYSTAIAILTIANIFAIVFAAVLDIIGKKHTWLSGEGELV 247
gi 1146122 169 GWKHSLFYIVTPVLAGGIGEGILPLSLGYSAITGLP-SEQLVGQLIPATIIGNFFAIMCSGLLSRLGEKRPELSGQGQLI 247
gi 1934815 176 SAYDSFFFVVVPIIAGGIGEGILPLSIAYSQILGSS-ADVFVSQLVPAAIIGNVFAIICAALMKKLGDKRPDLNGNGRLV 254
gi 623057  173 GFNYAILYIAMPIMAGGVGAGIVPLSGIYAHAMGVG-SAGILSKLFPTVILGNLLAIISAGLISRIFKD-SKGNGHGEIL 250
gi 1079560 173 GFNYAILYIAMPIMAGGVGAGIVPLSGIYAHAMGVG-SAGILSKLFPTVILGNLLAIISAGLISRIFKD-SKGNGHGEIL 250
gi 2130998 156 GFADSVMYVSMPMMSGGMGAGITPLSQIYAAGLAHGnQAAIFSQLAPAVTFGNILAIIGALSIAKVFNK-SKYNGHGTLV 234
gi 1783249 178 GFQHTLLYIVIPIMAGGVGEGAIPLSIGYSDIMPIS-QGEAFALVLPSIMLGSLCAIILAGLLNRIGKKKPEWTGNGKVD 256
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399259  248 RKAsfKTEDDEKAGQITHRETAVGMVLSTTCFLLAYVVAKKIL-PSIGGVSIhyFAWMVLIVAALNASGLCSPEIKAGAK 326
gi 399257  248 RKAsfKVEEDEKTGQITHRETAVGLVLSTTCFLLAYVVAKKIL-PSIGGVAIhyFAWMVLIVAALNASGLCSPEIKAGAK 326
gi 1146122 248 KIT--NSDDLSDALEEDKAPIDVKLMGAGVLIACTLFITGGLL-QHLTGFPG--PVLMIVVAAFLKYLNVVPKETQRGSK 322
gi 1934815 255 KSK--KANEIFNQKE-AEAKIDFKLMGAGVLLACTFFIFGGLL-EKFIFIPG--AILMIISAAAVKYANILPKKMEEGAY 328
gi 623057  251 RGE---REDAAAAAE--EIKPDYVQLGVGLIIAVMFFMIGTMLnKVFPGINA--YAFIILSIVLTKAFGLLPKYYEDSVI 323
gi 1079560 251 RGE---RED--AAAE--EIKPDYVQLGVGLIIAVMFFMIGTMLnKVFPGINA--YAFIILSIVLTKAFGLLPKYYEDSVI 321
gi 2130998 235 AAT---KEE--LAKP--KIKLDAQQIGTGMLFAFALLMAGDILnKFFPNIHQ--YAFMIIIVFILKATNTVPKDLEESVV 305
gi 1783249 257 RSE--EESPALEESQSGQQMFNLSLFASGGILAVSLYLVGMLA-HDFFGFPA--PVAMLLLAVLIKLFRLVPASIENGAF 331
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399259  327 RLSDFFSKQLLWVLMVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCMANRGGSG 406
gi 399257  327 RLSDFFSKQLLWVLMVGVGVCYTDLQEIINAITFANVVIAAIIVIGAVLGAAIGGWLMGFFPIESAITAGLCMANRGGSG 406
gi 1146122 323 QLYKFISGNFTFPLMVGLGMLYIPLKDVVGMLSWQYFVVVISVVFTVIATGFFVSRFMNMNPVEAAIVS-ACQSGMGGTG 401
gi 1934815 329 QLYKFISSSFTWPLMVGLGILFIPLDDVASVISIPFVIICISVVIAMIGSGYFVGKLMNMYPVESAIVT-CCHSGLGGTG 407
gi 623057  324 MFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQFVVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTG 403
gi 1079560 322 MFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQFVVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTG 401
gi 2130998 306 MFNQVIMTNLTHAVLAGIGLALIDLNTLASAFTWQFVVLCLTSVVVMGLASWFLARLFGLYPVETAIGAGMINNSMGGTG 385
gi 1783249 332 GVSRFFSTAVTYPLLFAIGVSMTPWDKLVAAFNLSNIITILSVVVTMMAVGFFTGKWLNMYPIETAIIN-ACHSGQGGTG 410
                      330       340       350
               ....*....|....*....|....*....|....*
gi 399259  407 DLEVLSACNRMNLISYAQISSRLGGGIVLVIASIV 441
gi 399257  407 DLEVLSACNRMNLISYAQISSRLGGGIVLVIASIV 441
gi 1146122 402 DVAILSTANRMTLMPFAQVATRLGGAITVITMTAI 436
gi 1934815 408 DVAILSASGRMGLMPFAQISTRLGGAGTVICATVL 442
gi 623057  404 NVAVLAASERMNLIAFAQMGNRIGGALILVVAGIL 438
gi 1079560 402 NVAVLAASERMNLIAFAQMGNRIGGALILVVAGIL 436
gi 2130998 386 NIAVLSASDRMEMIAFAQMANRLCGAIVLIFGGIL 420
gi 1783249 411 DVAILSAAERLELMPFAQVSTRIGGAITVSLTLLL 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap