Conserved Protein Domain Family
flhB_rel

?
TIGR00789: flhB_rel 
flhB C-terminus-related protein
This model describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set. [Unknown function, General]
Statistics
?
PSSM-Id: 129871
View PSSM: TIGR00789
Aligned: 5 rows
Threshold Bit Score: 116.776
Threshold Setting Gi: 15639896
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6968294    7 SIKKAVALGYQKEKNSAPKVLASGKGESAAKIISLAKEHGVPIKEDEDLIEILSKLDLGDEIPPNMYKAVAEVFAFIYQM 86
gi 446966790  3 KTIKAAALAYNMGQDHAPKVIASGVGEVAKRIIQKAKEYDIALFSNPMLVDSLLKVELDCAIPEELYESVVQVFLWLNSV 82
gi 490183574  5 EIKKAVALKYDPTRTSAPEVVAKGVGEVAERIIEMARRHGIPIEERPDIIDDLLRLDLFSEIPEEMYLVIAEIYAFLKRY 84
gi 499184814  4 KRACSVALSYATG-DKAPIIVASGTGAIAEKIVEIAKKFDIALVQDELLARVLSEHRIGACIPPETYQVVSAIFAFLYTQ 82
gi 489324695  6 PIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVELMRHLTVDDQIPEALYETVAEIFSFIYKL 85

                ..
gi 6968294   87 AN 88
gi 446966790 83 EN 84
gi 490183574 85 DK 86
gi 499184814 83 Q- 83
gi 489324695 86 DE 87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap