Conserved Protein Domain Family
gntP

?
TIGR00791: gntP 
gluconate transporter
This family includes known gluconate transporters of E. coli and Bacillus species as well as an idonate transporter from E. coli. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129873
View PSSM: TIGR00791
Aligned: 8 rows
Threshold Bit Score: 502.272
Threshold Setting Gi: 1169988
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851661    1 MPLIIVVAG--IALLLLLTIKIKLNTFVSLIIVSIAVAIASGMDLSKVVTSVESGLGGTLGHIGLIFGFGVMLGRLLADA 78
gi 121517     1 MPLIIVALG--ILALLFLIMGLKLNTFISLLVVSFGVALALGMPFDKVVSSIEAGIGGTLGHIALIFGLGAMLGKLIADS 78
gi 1169983    1 MPLLIVAIG--IVALLLLIMGLKLNTFVSLIIVSFGVALALGMPLDDIVKTIEEGLGGTLGHIALIFGLGAMLGRLIADS 78
gi 732052     1 MPLIIIAAG--VALLLILMIGFKVNGFIALVLVAAVVGFAEGMDAQAVLHSIQNGIGSTLGGLAMILGFGAMLGKLISDT 78
gi 17380429   4 LNILWVVFG--IGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNTLGELAIIVVFGAVIGKLMVDS 81
gi 1169988    4 LTLVLTAVGs-VLLLLFLVMKARMHAFLALMVVSMGAGLFSGMPLDKIAATMEKGMGGTLGFLAVVVALGAMFGKILHET 82
gi 1169431    4 QIWVVSTLLisIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIGLGTILGKMMEVS 83
gi 606350     1 MPLVIVAIG--VILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVAD-VGSLALIMGFGAMLGKMLADC 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851661   79 GGAQRIALTMLNYFGKNKLDWAVVCSAFIVGIALFFEVGLILLVPILFAIAREAKISPMFMCVPMLSGLLVAHGFLPPHP 158
gi 121517    79 GGAQRIAMTLVNKFGEKNIQWAVVIASFIIGIALFFEVGLVLLIPIVFAISRELKISILFLGIPMVAALSVTHGFLPPHP 158
gi 1169983   79 GGAQRIAMTLVNKFGEENIQWAVVIASFIIGVALFFEVALVLLIPIVFAISKELEISISYLGIPMTAALSVTHGFLPPHP 158
gi 732052    79 GAAQRIATTLIATFGKKRVQWALVITGLVVGLAMFFEVGFVLLLPLVFTIVASSGLPLLYVGVPMVAALSVTHCFLPPHP 158
gi 17380429  82 GAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVAFIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQP 161
gi 1169988   83 GAVDQIAVKMLKSFGHSRAHYAIGLAGLVCALPLFFEVAIVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLVPGP 162
gi 1169431   84 GAAERIGLTLQRCRWLS-VDVIMVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHP 162
gi 606350    78 GGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVLMLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHP 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851661  159 GPTVIAREYGADVGLVLIYGIIVGIPTFILCGPVLNKFCQRIIPDAFKkegniASLGATRRFSESEMPGFGISFLTAMLP 238
gi 121517   159 GPTAIAGEYGANIGEVLLYGFIVAVPTVLIAGPLFTKFAKKIVPASFAkngniASLGTQKTFNLEETPGFGISVFTAMLP 238
gi 1169983  159 GPTAIAGELGANIGEVLLYGIIVAIPTVLLAGPLFTKLAKKIVPQSFEkmgsiASLGEQKTFKLEETPGFGISVFTAMLP 238
gi 732052   159 GPTAIATIFEANLGTTLLYGFIITIPTVIVAGPLFSKLLTRFEKAPPE-----G-LFNPHLFSEEEMPSFWNSIFAAVIP 232
gi 17380429 162 GPVALVNAYGADMGMVYIYGVLVTIPSVICAGLILPKFLGNLERPTPS-----F-LKADQPVDMNNLPSFGVSILVPLIP 235
gi 1169988  163 APMLLASQMNADFGWMILIGLCAAIPGMIIAGPLWGNFISRYVELHIP------DDISEPHLGEGKMPSFGFSLSLILLP 236
gi 1169431  163 AALYVANKLGADIGSVIVYGLLVGLMASLIGGPLFLKFLGQRLPFKPVp----TEFADLKVRDEKTLPSLGATLFTILLP 238
gi 606350   158 GPTAIATIFNADMGKTLLYGTILAIPTVILAGPVYARVLKGIDKPIPE-----G-LYSAKTFSEEEMPSFGVSVWTSLVP 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851661  239 VILMAVVTIIQMTHAKSaadsGLFYNVILFLGNSTIAMLISLLFAIYTMGLGRGKTIPDLMDSCGKAIAGIAGLLLIIGG 318
gi 121517   239 IIIMSVATIIDLLQETIgfadNGVLAFIRLIGNASTAMIISLLVAVYTMGIKRNIPVKTVMDSCSTAISQIGMMLLIIGG 318
gi 1169983  239 VIIMSISTVITLIQETMgladNSLLAAVRLIGNASTSMVISLLVAIYTMGIARKIPIKQVMDSCSTAITQIGMMLLIIGG 318
gi 732052   233 VILMAIAAVCEITLPKT----NTVRLFFEFVGNPAVALFIAIVIAIFTLGRRNGRTIEQIMDIIGDSIGAIAMIVFIIAG 308
gi 17380429 236 AIIMISTTIANIWLVKD----TPAWEVVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVKSIAMVILIIGA 311
gi 1169988  237 LVLVGLKTIAARFVPEG----STAYEWFEFIGHPFTAILVACLVAIYGLAMRQGMPKDKVMEICGHALQPAGIILLVIGA 312
gi 1169431  239 IALMLVKTIAELNMARE----SGLYILVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTENGFGSIANILLIIGA 314
gi 606350   232 VVLMAMRAIAEMILPKG----HAFLPVAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIAMMLLIIGG 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851661  319 GGAFKQVLIDSGVGQYISTLVSGMDINPILMAWGVAAFLRICLGSATVAAISTAG-----LVIPLLAv--HPNTNLALIT 391
gi 121517   319 GGAFKQVLINGGVGDYVADLFKGTALSPIILAWLIAAILRISLGSATVAALSTTG-----LVIPLLG---HSDVNLALVV 390
gi 1169983  319 GGAFKQVLINGGVGDYVAELFKGTAMSPILLAWVIAAILRISLGSATVAALSTTG-----LVLPMLG---QSDVNLALVV 390
gi 732052   309 GGAFKQVLVDSGVGHYISHLMTGTTLSPLLMCWTVAALLRIALGSATVAAITTAG-----VVLPIIN---VTHADPALMV 380
gi 17380429 312 GGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVSAMTAAGiisaaILDPATGq--LVGVNPALLV 389
gi 1169988  313 GGVFKQVLVDSGVGPALGEALTGMGLPIAITCFVLAAAVRIIQGSATVACLTAVG-----LVMPVIEqlnYSGAQMAALS 387
gi 1169431  315 GGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATVAMMGATA-----IVAPMLPl--YPDISPEIIA 387
gi 606350   308 GGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAITAGG-----IAAPLIA---TTGVSPELMV 379
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 2851661  392 LATGAGSCICSHVNDASFWMIKDFFGLTTKETLLSWTLMSTLLSISGLIFILLASLVL 449
gi 121517   391 LATGAGSVIASHVNDAGFWMFKEYFGLSMKETFATWTLLETIISVAGLGFILLLSLVV 448
gi 1169983  391 LATGAGSVIASHVNDAGFWMFKEYFGLSMKETFATWTLLETIIAVAGLGFTLLLSLFV 448
gi 732052   381 LATGAGSVIASHVNDPGFWLFKGYFNLTVGETLRTWTVMETLISIMGLLGVLAINAVL 438
gi 17380429 390 LATAAGSNTLTHINDASFWLFKGYFDLSVKDTLKTWGLLELVNSVVGLIIVLIISMVA 447
gi 1169988  388 ICIAGGSIVVSHVNDAGFWLFGKFTGATEAETLKTWTMMETILGTVGAIVGMIAFQLL 445
gi 1169431  388 IAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVVALAGTFLLSFII 445
gi 606350   380 IAVGSGSVIFSHVNDPGFWLFKEYFNLTIGETIKSWSMLETIISVCGLVGCLLLNMVI 437
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap