Conserved Protein Domain Family
kup

?
TIGR00794: kup 
potassium uptake protein
Proteins of the KUP family include the KUP (TrkD) protein of E. coli, a partially sequenced ORF from Lactococcus lactis, high affinity K+ uptake systems (Hak1) of the yeast Debaryomyces occidentalis as well as the fungus, Neurospora crassa, and several homologues in plants. While the E. coli KUP protein is assumed to be a secondary transporter, and uptake is blocked by protonophores such as CCCP (but not arsenate), the energy coupling mechanism has not been defined. However, the N. crassa protein has been shown to be a K+:H+ symporter, establishing that the KUP family consists of secondary carriers. The plant high affinity (20mM) K+ transporter can complement K+ uptake defects in E. coli. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129876
View PSSM: TIGR00794
Aligned: 5 rows
Threshold Bit Score: 810.93
Threshold Setting Gi: 267165
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  130 LAYQSVGVIYGDIGTSPLYVFSSTFT---APPTHRD---LLQVLSVVIWSITILVTFKYIFVILHADNE-GEGGTFSCYS 202
gi 2746086   48 LAFQSVGIIYGDIGTSPLYVYSSTFPd--GIKNRDD---LLGVLSLILYTLIIIPMLKYVFIVLYANDN-GDGGTFALYS 121
gi 2654088   28 LAYQSLGVIYGDLSTSPLYVYKTTFSg--KLSLHEDdeeIFGVFSFIFWTFTLIALFKYVFIVLSADDN-GEGGTFALYS 104
gi 267165    12 ITLAAIGVVYGDIGTSPLYTLRECLSgqfGFGVERDa--VFGFLSLIFWLLIFVVSIKYLTFVMRADNA-GEGGILTLMS 88
gi 14917008  61 LGFSSLGAIYGDIGTSPLYVLNSIKYp-nSSPTEED---IYGAISIIFYLFTFIVIFKYILIVLFLGTNdGEGGQVAIYA 136
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  203 LLTRFANITERDPREE----------VTVRMERHLTNDLK---PPTRSLRAKLEGSrFTHVlLKIIGVLAVSMVMSDGVL 269
gi 2746086  122 LISRYAKIRLIPDQQA----------EDAAVSNYHIEAPNsqlKRAQWLKQKLESS-KAAK-IVLFTLTIPSMVIGDGTL 189
gi 2654088  105 LLCRYAKLSILPNHQE----------MDEKLSTYATGSPGe-tRQSAAVKSFFEKHpKSQKcLLLFVLLGTCMAIGDSVL 173
gi 267165    89 LAGR--NTSAR----------------------------------TTSM-------------LVIMGLIGGSFFYGEVVI 119
gi 14917008 137 KIARSLKIGPKGVHIPgspektdlelLARAETSSSFKSSNlflNKASGFKTNPKLIkFISKfILFGCFFGCSLVMSDGLL 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  270 TPAQSVLGAVQGLSVVKPDISKSTVTGTTCGILVLLFLIQPLGTSKIATTFAPIVIVWLGLNFSFGIYNLVTFDWTVLKA 349
gi 2746086  190 TPAISVLSAVSGIREKAPSLTQTQVVLISVAILFMLFSVQRFGTDKVGYTFAPVISVWFLLIAGIGMYNLVVHDIGVLRA 269
gi 2654088  174 TPTISVLSAVSGVKLKIPNLHENYVVIIACIILVAIFSVQRYGTHRVAFIFAPISTAWLLSISSIGVYNTIKWNPRIVSA 253
gi 267165   120 TPAISVMSAIEGLEIVAPQL-DTWIVPLSIIVLTLLFMIQKHGTAMVGKLFAPIMLTWFLILAGLGLRSIIA-NPEVLHA 197
gi 14917008 217 TPTTSVLSAIAGIQIANPSF--NDVLAVSEVVLIVLFLIQQFGSNKISFTFAPIIFLWLIGLIISGIYNIVKFHPAVFKS 294
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  350 FSPYFAFQFFIEHKTRAWKMLGGVLLSFTGVEALFADLGAFSLHAIQLSWMCYTYPCLLLAYIGQAAYISHHPDAYTNPF 429
gi 2746086  270 FNPMYIVQYFIRNGKSGWVSLGGIILCVTGTEGMFADLGHFNIRAVQLSFNGILFPSVALCYIGQAAYLRKFPDNVANTF 349
gi 2654088  254 LSPVYMYKFLRSTGVEGWVSLGGVVLSITGVETMFADLGHFSSLSIKVAFSFFVYPCLILAYMGEAAFLSKHHEDIQQSF 333
gi 267165   198 LNPMWAVHFFLEYKTVSFIALGAVVLSITGVEALYADMGHFGKFPIRLAWFTVVLPSLTLNYFGQGALLLKNPEAIKNPF 277
gi 14917008 295 LSPYYAIQLLKHSG-ID--VFSGAMLSITGTEAMFADVGHFGRLPIQLTLTLFVYPALIICYLGQGAYIIKHPEALSNPF 371
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  430 FNAAP----PGTLYPSLVIAILAAIVASQAMITATFQLISQIMKLSYCPQVKVVHTSQTFHGQIYVPFVNWLLMLGAILV 505
gi 2746086  350 YRSIP----APMFWPTFIVAILAAIIASQAMLSGAFAILSKALSLGCMPRVRVIHTSHKYEGQVYIPEVNFLMGLANIVV 425
gi 2654088  334 YKAIP----EPVFWPVFIVATFAAVVGSQAVISATFSIISQCCALDCFPRVKIIHTSSKIHGQIYIPEVNWMLMCLCLAV 409
gi 267165   278 FLLAP----DWALIPLLIIAALATVIASQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIPFVNWMLYVAVVIV 353
gi 14917008 372 FYSIPgglnSWIYWVMFVLATLSTIIASQALILGVFSITSQLINLDCFPNFKIIHVSKKYAGKVYIPAINWLLMIGVCAT 451
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  506 TAVYGDTVKLGNAYGVCVMFVTFFDTCMVTLVSLIVWKLSPFLVFVPWLVFASVDGLYLSAALIKVPEGAWFTLTLSGIL 585
gi 2746086  426 TVAFRTTTSIGHAYGICVVTTFAITTHLMTVVMLLIWKKHVMFIMLFYVVFGSIELIYLSSIMSKFIEGGYLPICFALVV 505
gi 2654088  410 TIGLRDTNMMGHAYGLAVTSVMLVTTCLMTLVMTIVWKQRIITVLAFVVFFGSIELLYFSSCVYKVPEGGWIPILLSLTF 489
gi 267165   354 IVSFEHSSNLAAAYGIAVTGTMVLTSILSTTVARQNWHWNKYFVALILIAFLCVDIPLFTANLDKLLSGGWLPLSLGTVM 433
gi 14917008 452 TAGFKNSNNVTAAYGLGITLDFLVTSSLIMVCMTYVYNWNILIPITYALIFLPLEVIMVISNLKKITHGAWFPLMMSGIF 531
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  586 TSLFLLWRFGKENQWRAEAEDRFKPSHLIVkdkne----------------------------------------ggrlr 625
gi 2746086  506 MSLMAAWHYVQVRRYWYELDHIVPISEMTM-------------------------------------------------- 535
gi 2654088  490 MAVMYIWNYGTTKKHEFDVENKVSMDRIVS-------------------------------------------------- 519
gi 267165   434 FIVMTTWKSERFRLLRRMHEHGNSLEAMIAs------------------------------------------------- 464
gi 14917008 532 MMFLSFWRWARSRKVNQDFKTRIRIGDLYPelkkqppqsetvdlndrgrpmsivnssneelveygvtlpkilktnnnqlk 611
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  626 LQPVWGgdpLSSLRGFGIFFD-------KTGVMTPAVFTHYVTKFVAIPEVAVFFHLHPVEAPTVLPEERYAVSHFTAVP 698
gi 2746086  536 LLEKNE---VRRIPGVGLLYT-------ELVQGIPPVFPRLIQKIPSVHSIFIFMSIKHLPISRVVPTERFIFRQVGPRE 605
gi 2654088  520 LGPSIG---MVRVPGIGLVYS-------NLVTGVPAVFGHFVTNLPAFHKILVFVCVKSVQVPYVGEEERFVISRVGPKE 589
gi 267165   465 LEKSPP----VRVPGTAVYMS-------RAINVIPFALMHNLKHNKVLHERVILLTLRTEDAPYVHNVRRVQIEQLSPTF 533
gi 14917008 612 VQSKFGlmnLKKYDGIAIMYNdssvhtlNSPNTVPQVYGKLVSSFSSIPSVFIFCSIRVLSIPTVPNDERVLIGSMKIPG 691
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  699 -GCYRLVIKHGFMDQVISP-DLAALIYEQIRRFVVRQATERMRALEKLRtge--dtDceGEGEQEaakGETSHRTessga 774
gi 2746086  606 hRMFRCVARYGYSDTLEEPkEFAAFLVDRLKMFIQEESAFALVQDQEESggagdvsDalARPRRStvhSEEAVQGqarvs 685
gi 2654088  590 yGMFRSVVRYGYRDVPREMyDFESRLVSAIVEFVETEPG--L-EEEEMS-------S--VRRKK-----EECME------ 646
gi 267165   534 ---WRVVASYGWRETPN-------------VEEVFHRCG-----LEGLS------------CRM---------------- 564
gi 14917008 692 --HYRCIIRYGFMEEILIDkELNNHILNSIPDINELAIKFNLNNKCILT----------KPCTIP---ILHIFEN----- 751
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724139  775 sgpdgvllpvelrdeeaAAELArld-rayASKILYVVGKEQMRIKTGAPIARRFMLS-VFLWIRDNTRAKIANLQLA--- 849
gi 2746086  686 shsas--grmsfhtsqaVEEEKqlidrevERGMVYLMGEANVTAEAKSSILKKIVVNhVYTFLRKNLTEGHKVLAIP--- 760
gi 2654088  647 -----------------IMEAK-------EAGVAYILGHSYAKAKQSSSVLKKLAVNvVFAFMSTNCRGTDVVLNVP--- 699
gi 267165   565 ------------------METS------------FFMSHESLILGKR-PWYLRLRGK-LYLLLQRNALRAPDQFEIP--- 609
gi 14917008 752 ------------------NLIR-------SHDYSSEEHETKNPLVKCKRFIRKILINhIFSPIYSDFQSNGKFLKISded 806
                       810
                ....*....|....*
gi 3724139  850 --TDRLVEVGFVKEI 862
gi 2746086  761 --KDQLLKVGITYEI 773
gi 2654088  700 --HTSLLEVGMVYYV 712
gi 267165   610 --PNRVIELGTQVEI 622
gi 14917008 807 eeSEKKMFLGGVVRI 821
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap