Conserved Protein Domain Family
rfc

?
TIGR00806: rfc 
RFC reduced folate carrier
The Reduced Folate Carrier (RFC) Family (TC 2.A.48) Members of the RFC family mediate the uptake of folate, reduce folate, derivatives of reduced folate and the drug, methotrexate. Proteins of the RFC family are so-far restricted to animals. RFC proteins possess 12 putative transmembrane a-helical spanners (TMSs) and evidence for a 12 TMS topology has been published for the human RFC. The RFC transporters appear to transport reduced folate by an energy-dependent, pH-dependent, Na+-independent mechanism. Folate:H+ symport, folate:OH- antiport and folate:anion antiport mechanisms have been proposed, but the energetic mechanism is not well defined. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129888
View PSSM: TIGR00806
Aligned: 6 rows
Threshold Bit Score: 655.027
Threshold Setting Gi: 2911843
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704   1 MVPTGQVAEKQACEEPRQDRELKSWRCLVFYLCFFGFMAQLRPGESFITPYLL--QQNFTIEQVTNEIIPVLPYSHLAVL 78
gi 1169706   1 MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGESFITPFLL--ERKFTKEQVTNEIIPMLPYSHLAVL 78
gi 1022955   1 MVPTGQVGEKQACEEPRQDRELKSWRWLVFYLCFFGFMAQLRPGESFITPYLL--ERNFTKEQVTNEIIPMLPYSHLAVL 78
gi 2911843   1 ---------------------MEQWKVMVL-ICMYGAVKEFRPTEPYMYEYQHt-VLNMSEQTLNSQVYPIWTYSYLITL 57
gi 1458343   1 ---------------------MGQWKVMIL-ICLYGAVKEFRPTEPYMYEYQHt-VLNISEHTLN--------------- 42
gi 1082371   1 MVPSSPAVEKQVPVEPGPDPELRSWRRLVCYLCFYGFMAQIRPGESFITPYLLgpDKNFTRDEVTNEITPVLSYSYLAVL 80
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704  79 VPIFLLTDYLRYKPILILQCLSFMCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVRPSRYQRMASYSRAAV 158
gi 1169706  79 VPVFLLTDYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAV 158
gi 1022955  79 VPIFLLTDYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSITMAARIAYSSYIFSLVQPSRYQRMASYSRAAV 158
gi 2911843  58 IPAFLLTDVFLYKPLLVFEAFSYFLCWVIFVFGKSVWSQQVLEVFYGWATATEIAYFAYIYVKVPKTEYKSATAFTRAAL 137
gi 1458343  43 -------NVLLYKPILIIEALSYFACWMIFVFGRSVWCMQLLELFYGWATATEIAYFAYIYVKVPKEDYKSATAYTRAAL 115
gi 1082371  81 VPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAV 160
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704 159 LLGVFTSSVLGQVLWPLEQKSqnSNMLNYISLGFIIFSLGLSLFLK-RPKHSLFFNRSALVH-KALPCELDQMHPGPGrp 236
gi 1169706 159 LLGVFISSVLGQALVTVGHIS--TYTLNCVSLGFILFSLVLSLFLK-RPKRSLFFNRSTLAR-GALPCELDQMHPGPDrp 234
gi 1022955 159 LLGVFISSVLGQVLVTLGGIS--TYMLNCISLGFILFSLSLSLFLK-RPKRSLFFNRSALVQ-GALPCELDQMHPGPGrp 234
gi 2911843 138 LVGRFLAYALAQLLIGLNWTS--YSTLNIISLVAMTIAVFLALILPgVEWKEAYEKKLEDNN---VQGNLKEIVDQSS-- 210
gi 1458343 116 LVGRFLAYTLAQLLIGLNWAD--YMTLNIINLVSMTFAVFLAAILPhVPWRNAYQKKLEDKK---SVTDLESLVSEAK-- 188
gi 1082371 161 LLGVFTSSVLGQLLVTVGRVS--FSTLNYISLAFLTFSVVLALFLK-RPKRSLFFNRDDRGRcETSASELERMNPGPG-- 235
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704 237 epGKLERVLG-SCRNSFLVCMLSELVGNLRQPHVRLWCLWWVFNSAGYYLIVYYVHVLW-SIDKNLN----YNGAVDAAS 310
gi 1169706 235 etRKLDRMLG-TCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGYYLITYYVHVLWrSTDSSLS----YNGAVDAAS 309
gi 1022955 235 epRKLERMLG-TCRDSFLVRMLSELVKNVRQPQLRLWCLWWVFNSAGYYLITYYVHVLWkITDSRLN----YNGAVDAAS 309
gi 2911843 211 ----YMDYLR-----MFFVGLRHNLMAIYRNPLILKWSVWSALSSCIFYQVTNYTQTLWgTLPESANr---YNGITEALV 278
gi 1458343 189 ----YSDYLK-----LFFVELHQNLYTIYKNPLVLKWSIWSALSSCIFYQIINYTQTLWgTLPEKENk---YNGIPEALV 256
gi 1082371 236 --GKLGHALRvACGDSVLARMLRELGDSLRRPQLPLWSLWWVFNSAGYYLVVYYVHILWnEVDPTTNsarvYNGAADAAS 313
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704 311 TLLSAITSFSAGFVKIRWALWSKLVIASVIAIQAGLVFCMYMVHyvtwvhKIWVLYMTYVLFRGAYQFLVPIATFQIASS 390
gi 1169706 310 TLLSAITSFSAGFLSIRWTLWSKLVIAGVIAIQASLVFCMFQIR------DIWVCYVTFVLFRGAYQFLVPIATFQIASS 383
gi 1022955 310 TLLSAITAFTAGFVNIRWALWSKLVIASVIAIQAGLVFCMFQIP------DIWVCYVTFVLFRGAYQFLVPIATFQIASS 383
gi 2911843 279 PLLGIPADLITRQLNVNWNRWGDLLLAVGSIGQAGLLFWMSQSH------HIVVLYLSYIFYRVIYQLTTTIAQSTLAFS 352
gi 1458343 257 PLLGIPADLITRQMNVNWNRWGDALISVGSLLQAGLLFWMSQSH------EIIILYICYIIYRVIYQLTTTIAQSTLALT 330
gi 1082371 314 TLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRhp---sSIWLCYAAFVLFRGSYQFLVPIATFQIASS 390
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169704 391 LSKELCALVFGINTFLATALKTAITLVVSDKRGLGLKVEKQFCIYSVYFMVLS--VICFVGAVLDGVRYCRRGRHQ---- 464
gi 1169706 384 LSKELCALVFGINTFLATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLS--ITCFAWAGLDGLRYCQRGRHQ---- 457
gi 1022955 384 LSKELCALVFGINTFLATALKTSITLVVSDKRGLGLQVHQQFRIYFMYFLTLS--IICLAWAGLDGLRYYRRGRHQ---- 457
gi 2911843 353 LDSRLFGLLFGINTFVALLLQSILTAVVIDWQKL--DIRPQFVVYSCYHLVVAfgFAIIFG-IWASRRFFKTSTN----- 424
gi 1458343 331 LDSRLFGLLFGINTFVALALQSILTAIVIDAEKL--AIRAQVDFHLNKNILFGsfSVCEFGRAMGNAGKGKRPTEYnvee 408
gi 1082371 391 LSKELCALVFGVNTFFATIVKTIITFIVSDVRGLGLPVRKQFQLYSVYFLILS--IIYFLGAMLDGLRHCQRGHHP---- 464
                      490       500       510       520       530       540
               ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1169704 465 -PLPLPQEL--SPLENSVQVPSMQDRGLGGL---QPSAPQLLPEDG--------VEDSEASLRAEAKA 518
gi 1169706 458 -PLAQAQELr-SPLETSVQAISLQDGDLRGP---QPSAPQLLSEDG--------MEDDRGDLRVEAKA 512
gi 1022955 458 -PLAQAQAL--SPLEDSVQAISLQDGDLRRP---QPSAPQLLPEDGs-------VEDGRADLRVEAKA 512
gi 2911843     --------------------------------------------------------------------
gi 1458343 409 dEFAPRHQRevDPEQEAQRQQVLGDRQRRMDrvaEPHWVHRMELEPtv-----sHWLDRKPLMYDFQF 471
gi 1082371 465 -RQPPAQGLrsAAEEKAAQALSVQDKASEACs--QPRARRFPQKTAwglwgqppWSRDRATHTCPAPA 529
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap