Conserved Protein Domain Family
malonate_madL

?
TIGR00807: malonate_madL 
malonate transporter, MadL subunit
The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM. The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129889
View PSSM: TIGR00807
Aligned: 3 rows
Threshold Bit Score: 154.188
Threshold Setting Gi: 6642781
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6642781   1 MIIYGTAILAVCHLLGVYLGNILGMALGVKANVGGVAIAMILLIISKELLAKRGHLPQVTQFGVLYWSGMYIPIVVAMSA 80
gi 2062656   1 MVIYGVALLSGCFLVGKVTGSWLGAAIGVKANVGGVGISMLLLVIVCDILIKKGKLKQLSQDGIGFWNAMYIPIVVAMAA 80
gi 4062980  24 MIIYGVALLAVCTLAGVIVGDFLGVLLGVKSNVGGVGIAMILLICARLYMHRNGGMSKECEFGVGFWGAMYIPVVVAMAA 103
                       90       100       110       120
               ....*....|....*....|....*....|....*....|....*..
gi 6642781  81 GQNVVAALSGGMLGLIVSVASLIGTVLVIRWLNKSSgdYATYEWAVE 127
gi 2062656  81 KQNVIGAIDGGWLALLAGGVATVVSYFMIPVISKLG--QGTKVPAIE 125
gi 4062980 104 QQNVVTALHGGPVALLAAVGAVLVCGLTIALISRSH--RGEPLPALE 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap