Conserved Protein Domain Family
malonate_madM

?
TIGR00808: malonate_madM 
malonate transporter, MadM subunit
The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129890
View PSSM: TIGR00808
Aligned: 3 rows
Threshold Bit Score: 333.774
Threshold Setting Gi: 2062657
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062657   1 MWDILVAQLTQNGLITSFVIVGVTMYVAYMLSAKLTKGKFHGSAIAIILGLVLAYVGGAATdGGSKGLASIPMFAGVGLM 80
gi 4062981   1 MWPIIENALEHNGLITAFAVVGAIMWLSVLLSKYLTFGRVHGSAIAIVIGLVLAWVGGTVT-GGQKGLADMALFSGIGLM 79
gi 4103488   1 MEEIVT-VLTKNALVTALAVTGLMMYVSHLLSKYLTKGKLQSSAIAITMGLVLAYFAGVYT-QGEKGISDIAIFGGFALL 78
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062657  81 GGSMLRDLAIVATSFGVDLREVKKSGLSGTVSLFMGIFVSFFIGAGMAIAFGYTDAVSITTIGAGAVTYIVGPVTGAAVG 160
gi 4062981  80 GGAMLRDFAIVATAFEVQATEARKAGMIGAVALLLGTVLPFIVGAAVAYAFGYRDAVSMTTIGAGAVTYIVGPVTGAALG 159
gi 4103488  79 GGAMLRDLAIASTAFEVDVKEVKKAGKVGMIALLLGCVIPFVIGAMVAWVMGYRDPASMTTIGAGAMTYIVGPVTGTAVG 158
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062657 161 ADSAVVALSVAAGLVKSILVMTSTPLFAKIVGLDNPNSAMVFGGLMGTTSGVTAGLAATNPKLVPYGAMTSTFYTGLGCL 240
gi 4062981 160 ASSDVMALSIATGLIKAILVMVFTPVSARLLALDNPRSAMVFGGLAGTVSGVTAGLAATDRRLVPYGALTATFHTGLGCL 239
gi 4103488 159 ASSEVIALSIAIGLIKAVFFMVGTPLLAKFMYLKSPRSAMVFGGLAGTTSGTAAGLAGTDVRLVPYGALVATFYTGLGCL 238
                      250
               ....*....|....*
gi 2062657 241 LCPSVLFLLMKGIYG 255
gi 4062981 240 MGPSILYFCIRGLVG 254
gi 4103488 239 LGPSVFFLTVNAIFG 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap