Conserved Protein Domain Family
EIID-AGA

?
TIGR00828: EIID-AGA 
PTS system, mannose/fructose/sorbose family, IID component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man family is unique in several respects among PTS permease families.It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IID subunits of this family of PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129908
View PSSM: TIGR00828
Aligned: 4 rows
Threshold Bit Score: 388.012
Threshold Setting Gi: 1172735
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 131485   14 KKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPeNNEARKQAIRRHLEFFNTQPFVAAPILGVTLALE 93
gi 548634    4 KKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYP-LKADQVAALKRHLVFFNTTPAVCGPVIAVTAAME 82
gi 126221    5 KRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYG-PGAKRNEALQRHLEWFNTHPWLTAPIFGVTAAME 83
gi 1172735   3 SEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKdDKPGLSAAMKDNLEFINTHPNLVGFLMGLLISME 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 131485   94 EQRANGAEIDDGAINGIKVGLMGPLAGVGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGY 173
gi 548634   83 EARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLRPITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGF 162
gi 126221   84 EEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGY 163
gi 1172735  83 EKGENR----D-TIKGLKVALFGPIAGIGDAIFWFTLLPIMAGICSSFASQGNLLGPILFFAVY-LLIFFLRVGWTHVGY 156
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 131485  174 SKGIDIVKDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMPGLVPLLLTFA 253
gi 548634  163 RKGVNIVSDMGGNLLQKLTEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLTLL 242
gi 126221  164 VKGMEILQDLAGNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGLTLL 243
gi 1172735 157 SVGVKAIDKVR-ENSQMIARSATILGITVIGGLIASYVHINVVTSFAIDNTHS----VALQQDFFDKVFPNILPMAYTLL 231
                      250       260       270
               ....*....|....*....|....*....|..
gi 131485  254 CMWLLR-KKVNPLWIIVGFFVIGIAGYACGLL 284
gi 548634  243 MVRLLN-KKVNPVWLIFALFGLGIIGNALGFL 273
gi 126221  244 VAWMLR-KGVNPLLIICGIFVIGILGYWAGFL 274
gi 1172735 232 MYYFLRvKKAHPVLLIGVTFVLSIVCSAFGIL 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap