Conserved Protein Domain Family
a_cpa1

?
TIGR00831: a_cpa1 
Na+/H+ antiporter, bacterial form
The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36) The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals. Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in (1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles. This model is specific for the bacterial members of this family. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129911
View PSSM: TIGR00831
Aligned: 3 rows
Threshold Bit Score: 573.37
Threshold Setting Gi: 2649761
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553    7 ILIMTLVVSLSGVVTRVMPFQIPLPLMQIAIGALLAWPTFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIF 86
gi 2498053  17 VVIVALVAAVVVGTVLGHRYRVGPPVLLILSGSLLGLIPRFGDVQIDGEVVLLLFLPAILYWESMNTSFREIRWNLRVIV 96
gi 2649761   7 VEFIEILMLATAVAVTVKFIRLPYTIALVLAGLFVGLAGLLPEVPLSREIVFFIFLPPLLFEAAMNMDLKELRENFGPIA 86
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553   87 GLALALVVVTVVGIGFLIYwvVPGIPLIPAFALAAVLSPTDAVALSGIVGegRIPKKIMGILQGEALMNDASGLVSLKFA 166
gi 2498053  97 MFSIGLVIATAVAVSWTAR--ALGMESHAAAVLGAVLSPTDAAAVAGLAK--RLPRRALTVLRGESLINDGTALVLFAVT 172
gi 2649761  87 LIAFLGVVVTTTVVGFSLNw-ILGIPLALALIFGAMVSATDPVSVLATFKsiSAPKKLSILIEGESVLNDGAAIVVFAIA 165
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553  167 VAVAMGTMIFTVGGATVEFMKVAIGGILAGFVVSWLYGrslrfLSRWGGDEPATQIVLLFLLPFASYLIAEHIGVSGILA 246
gi 2498053 173 VAVAEGAAGIGPAALVGRFVVSYLGGIMAGLLVGGLVT-----LLRRRIDAPLEEGALSLLTPFAAFLLAQSLKCSGVVA 247
gi 2649761 166 LEMML-KGVFDPLNAALDFAVVCVGGAAVGLAVGYLAYr----IL-AKIDDALVEIAVTIVAAYLGFVLAERFHFSGVIA 239
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553  247 AVAAGMTITRSGVMrRAPLAMRLRANSTWAMLEFVFNGMVFLLLGLQLPGILETSLMAAEIDPNVEIWMLFTNIILIYAA 326
gi 2498053 248 VLVSALVLTYVGPT-VIRARSRLQAHAFWDIATFLINGSLWVFVGVQIPGAIDHIAGEDGGLPRATVLALAVTGVVIATR 326
gi 2649761 240 VVAAGLILGNYGRDfSMSPTTRVIMLDFWSVIVFLVNSIIFILIGVNTHITIFSAWKEILVAIAAVILAR---AFVVYPV 316
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553  327 LMLVRFgwLWTMKKFSNRFLKKKPMEFGswtTREILIASFAGVRGAITLAGVLSIPLLLPDGNVFPARYELVFLAAGVIL 406
gi 2498053 327 IAWVQA--TTVLGHTVDRVLKKPTRHVG---FRQRCVTSWAGFRGAVSLAAALAVPMTTNSGAPFPDRNLIIFVVSVVIL 401
gi 2649761 317 MTYYRF-------P--N---------------LWKHVVFWGGLRGVIPVALALSFGNQLLSAMAFG-----------VVL 361
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418553  407 FSLFVGVVMLPILLQHIEVADHSQQLKEERIARAATAEVAIVAIQKMEERLAadTEENIDNQLLTEVSSRVIGnlrRRAD 486
gi 2498053 402 VTVLVQGTSLPTVVRWARMPEDVAHANELQLARTRSAQAALDALPTVADELG--VAPDLVKHLEKEYEERAVL---VMAD 476
gi 2649761 362 FSLLLQGISLEIFVKRKFVSE-SERELEEIIARYIAARSAKFELMKAVEQGR--IVEPVAREMLPNLDAEIEE---LRSK 435
                      490       500       510       520       530       540
               ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 418553  487 GRNDVESSVQEEN-LERRFRLAALRSERAELYHLRATREISNETLQKLLHDLDLLEALLIE 546
gi 2498053 477 GADSATSDLAERNdLVRRVRLGVLQHQRQAVTTLRNQNLIDDIVLRELQAAMDLEEVQLLD 537
gi 2649761 436 LEEKIRGGMGSKL--RKAAVKYVIDAKKSAVVDAMAGGLVSQEVALEIMRELDSKTAELME 494
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap