1TJ7


Conserved Protein Domain Family
argH

?
TIGR00838: argH 
Click on image for an interactive view with Cn3D
argininosuccinate lyase
This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 129918
View PSSM: TIGR00838
Aligned: 11 rows
Threshold Bit Score: 640.556
Threshold Setting Gi: 6225066
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TJ7_A       3 LWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARp-QqILESDA 81
gi 416644    3 LWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARpqQ-ILESDA 81
gi 1168497   3 LWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTIEEQHQLEQALNELLVEVRSNpqA-ILQDDA 81
gi 6685226   5 TWSDRFEGTLHPAIALFNASIGFDIELIEYDLDGSIAHGKMLAKTGIISPGEAEQLVQGLEQIRQEYRAGn-F-NPGVDQ 82
gi 6685222   4 LWGGRFQKTPEKWVDEFGASISFDQNLVAEDITGSLAHAAMLKKCGILTAEEELKIREGLNTLLQKAEEGa-L-EFSVDY 81
gi 6686386   4 PWSGRFKEETDKFVEDFTESVSFDKELAFEDIEQDIAHVKTLQKAGILTEEEARELIQELLKIKEEIKEGk-F-QWKKEL 81
gi 728893    8 LWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTETELAKIHEGLAEIKKEWDADk-F-VRHPND 85
gi 6225066   8 LWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLDSLAQDVADGs-F-GPLVTD 85
gi 2492945   4 LRRGRLGNSIKEDVAKYTTSLSFDKEIFEADILCDIAHVIMLYEQGIIKKEDAKKIIEGLKEIYKKGMEN--L-NLDPSL 80
gi 6686377   2 LRESRMKKGMDPKALKLSSSIEHDKNIFLYDILVDVAHVLTLKKGGYLSEEEAKEIILALKKVKDSGFR------EDWPY 75
gi 6685219   3 LRAGRLNSGMEDEAAEFTSSLTFDHHIFEADIECNMAHTRMLAHEGIIPEEVAAKIIDALESLREEGIEA--L-DMDPSV 79
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TJ7_A      82 EDIHSWVEGKLIDKVG-QLGkKLHTGRSRNDQVATDLKLWCKDTVSE-LLTANRQLQSALVETAQNNQDAVMPGYTHLQR 159
gi 416644   82 EDIHSWVEGKLIDKVG-QLGkKLHTGRSRNDQVATDLKLWCKDTVSE-LLTANRQLQSALVETAQNNQDAVMPGYTHLQR 159
gi 1168497  82 EDIHSWVESKLIDKVG-NLGkKLHTGRSRNDQVAVDIKLWCKQRVIE-LQESVRNLQRHLVQTAENTQQAVMPGYTHLQR 159
gi 6685226  83 EDVHFAVERRLTELVG-DVGkKLHTARSRNDQVGTDVRLYLRAQIDD-IRQRLRDFQAVLLQLAETNVETLIPGYTHLQR 160
gi 6685222  82 EDIHLNIEKMLIDEIG-PLGgKLHTGRSRNDQVATDMHLYLKNHVGH-IIELIEAFQSALIEKAEANVETILPGYTHLQR 159
gi 6686386  82 EDVHMNIEAELINRLG-DVGrKLHTARSRNDQVATDEKLYLKKEIKE-VLQLLKELRKTLVELAETTVDFVMPSYTHLQR 159
gi 728893   86 EDIHTANERRLGELIGrDIAgKVHTGRSRNDQVVTDLRIYCRDIVNDtLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQR 165
gi 6225066  86 EDVHAALERGLIDRVGpDLGgRLRAGRSRNDQVAALFRMWLRDAVRR-VATGVLDVVGALAEQAAAHPSAIMPGKTHLQS 164
gi 2492945  81 DDIHMVIESELIKKLGeDVAgRMHTGRSRNDEVATDLRIALREKVLI-IAKSLIKMLKDILELAEKHKETLIVGYTHLQH 159
gi 6686377  76 EDVHEAIEAEVTKITPhGAK--MHTGRSRNDEVATCLRMFARDHLLN-LAEAILNALDVLIKKAEKS-HFLMPGFTHLQY 151
gi 6685219  80 EDIHMAVENYVTARIGeEAG-FMHTGKSRNDQVATDLRLALRERIRT-ISRELLDFIDSISDLALDHTETVMVGYTHLQH 157
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TJ7_A     160 AQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELL 239
gi 416644  160 AQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELL 239
gi 1168497 160 AQPITFAHWCMAYVEMFDRDYSRLTDAYNRMNTCPLGSGALAGTAYAVDRDSLAHDLSFAFATRNSLDSVSDRDHIVELL 239
gi 6685226 161 AQPVSLAHHLLAYFQMAQRDWQRLGEIRARTNVSPLGSGALAGTTFPIDRHYSAELLGFAGVYANSLDGVSDRDFAIEFL 240
gi 6685222 160 AQPISFAHHLLAYFWMLERDKERFQDSMKRINKSPLGCGALAGTTFPIDRDYSAELLGFDAIYENSLDGVSDRDFILEFL 239
gi 6686386 160 AQPIRVAHYFLAYREILLKDSERLMDTYRRVDELPLGSGAVAGVDFPLDRFYTAELLGFNRVTRNSMYATAERDFIIEFL 239
gi 728893  166 AQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALAGHPYGIDREFLAEGLGFNSVIGNSLVAVSDRDFIVELM 245
gi 6225066 165 AQPILLAHHLLAHAHPLLRDLDRIVDFDKRAAVSPYGSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFAAEAA 244
gi 2492945 160 AQPVTFAHHLLSYVSAIERDILRLLDAYKRINISPLGCGAMATTGFKINRERTKELLGFDALIENSMDGVSARDFILETM 239
gi 6686377 152 AQPTRLSHHLLAYHDMLSRDFERAIEAFRRVNKSPLGSAAFASTGYSLDRVYAARLLGFDGVVEHSEDAVASRDFVIESI 231
gi 6685219 158 AQPTTLGHHLMAYASSLRRDYERLQDTLKRVDQNPLGSAAMTTTSFPINRELTTRLLGFSDYMKNSMDAVSARDFIAETV 237
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TJ7_A     240 SAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNK 319
gi 416644  240 SAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNK 319
gi 1168497 240 SIASLSMAHLSRFAEDMIIFNSGEANFVELSDRVTSGSSLMPQKKNPDACELIRGKTGRVIGSLTSMLITLKGLPLAYNK 319
gi 6685226 241 NAASLIMVHLSRLSEEMILWASQEFSFISLTDSCATGSSIMPQKKNPDVPELIRGKAGRVMGHLQGMLVLMKGLPLAYNK 320
gi 6685222 240 SNSSMLMMHLSRFSEEIILWCSQEFKFIELDDTYATGSSMMPQKKNPDMAELIRGKTGRVYGDMMGLFTIMKGLPLAYNK 319
gi 6686386 240 SNCALIAQHLSRLAEDLIIWNTEEFNFVELPDKLCTGSSIMPQKKNPDVLELIRGKTGRIYGNLIALLTTMKALPMAYNR 319
gi 728893  246 FWGTLFMNHISRFAEDLIIYCTAEFGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLTGFLMSLKGIPSTYDK 325
gi 6225066 245 FVFAMIAVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGKSGRLIGNLAGLLATLKAQPLAYNR 324
gi 2492945 240 ADLAILGTNLSKICEELILFSTYEFGTIEIANEFCSTSSIMPQKKNPDVAEIARAKLSKLNGNLVTALTILKALPNTYNR 319
gi 6686377 232 FVAAEAMLSISRIAEEIVLFSS-EFGFITLPDEFSSTSSIMPQKKNPDIAELLRANAGKIAGNLTSAMMIYKATPFSYNR 310
gi 6685219 238 FDLSMLAVNLSRISEEMILWSTHEFGIVEIPDEFSSTSSIMPQKKNPDVAEIARAKTSTVQGELVTILGIMKALPYTYNR 317
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TJ7_A     320 DMQEDKEGLFDALDTWLDCLHMAALVLDG-IQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIR 397
gi 416644  320 DMQEDKEGLFDALDTWLDCLHMAALVLDG-IQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIR 397
gi 1168497 320 DMQEDKEGIFDALDTWQNCVDMATFVLDE-LKVNVERTREAALKGYSNATELADYLVSK-GVPFRDSHHIVGETVVYAIE 397
gi 6685226 321 DLQEDKEALFDAVKTVQVSLEAMTILLDEgIVFRQERLAEAVAEDFSNATDVADYLAAK-GVPFREAYNLVGKVVKTSLA 399
gi 6685222 320 DLQEDKEGMFDTVKTVEGSLQIFTGMIQT-MTVNKDVMKQATKQDFSNATELADYLAKK-GMPFREAHEVVGKLVYTCIE 397
gi 6686386 320 DMQEDKEPLFDTLKNLKNMIKGMTLVLSD-LRVKEQN-MRKASGNFLLITDIANYLVEK-GVPFRTAHHIAGSIVAYLLE 396
gi 728893  326 DMQEDKEPLFDCLTTVEHSMLIATGVIST-LTVNKEK-MEAALTMDMLATDLADYLVRK-GVPFRETHHISGECVATAER 402
gi 6225066 325 DLQEDKEPVFDSVAQLELLLPAMAGLVAS-LTFNVQRMAELAPAGYTLATDLAEWLVRQ-GVPFRSAHEAAGAAVRAAEQ 402
gi 2492945 320 DLQEISPHLWDSVYTTIDTIKMVHGMLKT-IKINKERMEELAKANYSTATELADTLVREtGIPFRTAHGIVGEVVRRSIE 398
gi 6686377 311 DFQEMNPLLYESLKRTHLAVEVFASMMGK-IKFNPEITERKASKGFATATELADMLVMKyGVPFRMAHRIVGRLAAKELE 389
gi 6685219 318 DLQEVTPHLWRAVDTVLSMIRVVRGMLLG-IRVNRNRALELAGANFATATDLADIIVRErGIPFRVAHRIVGRLVTRAIE 396
                      410       420       430       440       450       460       470
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
1TJ7_A     398 QGK--------PLEDLPLSELQKfSQVIDED-VYPILSLQSCLDKRAAKGGVSP---QQVAQAIAFAQARLG 457
gi 416644  398 QGK--------PLEDLPLSELQKfSQVIDED-VYPILSLQSCLDKRAAKGGVSP---QQVAQAIAFAQARLG 457
gi 1168497 398 KGK--------GLEDLTIPEFRQfSEVVGDD-VYEILSLQSCLDKRCAKGGVSP---LRVAEAIAEAKTRFA 457
gi 6685226 400 AGK--------LLKDLTLAEWQAlHPAFEED-IYQAITPQQVVAARNSYGGTGF---EQVKMAIANAKAELS 459
gi 6685222 398 RGI--------YLSDMPFGEFQQaSTLFEED-IYTVLDPYYAVEKRMSAGGTGF---KQVEQALEKAKACVA 457
gi 6686386 397 KGK--------KLEEMTLEEFKQfSEKFEED-VFDILSPERAADRKRVYGGTAK---EEILRIIEVAKAEEG 456
gi 728893  403 LGLs-------GIDKLTLEQYQKiDSRFGQD-LFETFNFEQSVERRDATGGTAK---SAVLKQLDNLKSQLN 463
gi 6225066 403 RGV--------GLQELTDDELAAiSPELTPQ-VREVLTIEGSVSARDCRGGTAPgrvAEQLNAIGEAAERLR 465
gi 2492945 399 Ek--------kDMIEVIYEVLEKyNLKVDEEkIKKALDPYENVKMRDVIGGPAP---EEVEKRIKVFRERLD 459
gi 6686377 390 Rpt------asDVNSAAKELGVE--INVRDEdVLEALDVEKVVENRGNLGGTSK---AEVERMIKARKSDLK 450
gi 6685219 397 DGLapgdvdsvYLDEVSLEVTGR-KLELDPElVEKALDPLENVRMRRIPGGPAP---EMVRVAVEEMKSFIE 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap