Conserved Protein Domain Family
benE

?
TIGR00843: benE 
benzoate transporter
The benzoate transporter family contains only a single characterised member, the benzoate transporter of Acinetobacter calcoaceticus, which functions as a benzoate/proton symporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129923
View PSSM: TIGR00843
Aligned: 2 rows
Threshold Bit Score: 526.446
Threshold Setting Gi: 543886
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1742339  29 MLRCLYAITHEVTMRlFSippptlLAGFLAVLIGYASSAAIIWQAAIVAGATTAQISGWMTALGLAMGVSTLTLTLWYRV 108
gi 543886    1 MTTLLKTLKQDWSLS-AT------IAGFLAVLISYSGPLIIFFQAAQKAHVSTEMMISWIWAISIGAAVTGIFLSIRFKT 73
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1742339 109 PVLTAWSTPGAALLVTGLQGLTLNEAIGVFIVTNALIVLCGITGLFARLMRIIPHSLAAAMLAGILLRFGLQAFASLDGQ 188
gi 543886   74 PVVTAWSAPGTALLVTLFPNISLNEAVAAYITAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTL 153
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1742339 189 FTLCGSMLLVWLATKAVAPRYAVIAAMIIGIVIVIAQGDVVTTDVVFKPVLPTYITPDFSFAHSLSVALPLFLVTMASQN 268
gi 543886  154 PLIVFSMLLCYLISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDFQIARPQFIAPEWSWFSTLNLALPLILVSLTGQF 233
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1742339 269 APGIAAMKAAGYSAPVSPLIVFTGLLALVFSPFGVYSVGIAAITAAICQSPEAHPDKDQRWLAAAVAGIFYLLAGLFGSA 348
gi 543886  234 LPGMAILKLSGYNTPAKPIIAAASLASLFAAFAGGITIVLASITATLCMGKDAHELKDKRYIAGIANGLFYVLGGVFAGS 313
                      330       340       350       360       370       380       390
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1742339 349 ITGMMAALPVSWIQMLAGLALLSTIGGSLYQALHNERERDAAVVAFLVTASGLTLVGIGSAFWGLIAGGVCYVVL 423
gi 543886  314 IVALFSLLPKELVAALAGLALLGAIASNIKIAMQEDQQRDPALITFLATVSGMHFLGLSSVFWGMCIGMLAYFIL 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap