Conserved Protein Domain Family
mtlA

?
TIGR00851: mtlA 
PTS system, mannitol-specific IIC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Fru family is a large and complex family which includes several sequenced fructose and mannitol-specific permeases as well as several putative PTS permeases of unknown specificities.The Fru family PTS systems typically have 3 domains, IIA, IIB and IIC, which may be found as 1 or more proteins. The fructose and mannitol transporters form separate phylogenetic clusters in this family. This family is specific for the IIC domain of the mannitol PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129930
View PSSM: TIGR00851
Aligned: 4 rows
Threshold Bit Score: 557.896
Threshold Setting Gi: 1709899
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709899    14 KIQRFGSYLSGMIMPNIGAFIAWGIITALFIPTGWLPNETFAKLVGPMITYLLPLLIGYTGGKMIYDVRGGVVGATATMG 93
gi 790940     14 KVQRFGSYLSGMIMPNIGAFIAWGIITALFIPAGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIG 93
gi 131498      8 KVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLLPLLIGYTGGKLVGGERGGVVGAITTMG 87
gi 506381185  13 KVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWFPNKDLAQLAGPMITYLIPLLIAFSGGRLIHDLRGGIIAATATMG 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709899    94 VIVG-SDIPMFLGAMIMGPLGGYLIKKFDQQIQGKVKQGFEMLVNNFSAGIIGGLLTLAAFKGVGPVVSAISKTLAAGVE 172
gi 790940     94 VIVG-SDIPMFLGAMIMGPLGGYLIKQTDKLFKDKVKQGFGIRINNFTAGIVGAALTILAFYAIGPVVLTLNKLLAAGVE 172
gi 131498     88 VIVG-ADMPMFLGSMIAGPLGGWCIKHFDRWVDGKIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVEALSKMLAAGVN 166
gi 506381185  93 VIVAlPDTPMLLGAMIMGPLVGWLMKKTDEFVQPRTPQGFEMLFNNFSAGILGFIMTIFGFEVLAPIMKFIMHILSVGVE 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709899   173 KIVDLHLLPLANIFIEPGKVLFLNNAINHGILSPLGIEQAAKTGKSILFLLEPNPGPGLGILLAYWLFGKGMAKQSAPGA 252
gi 790940    173 VIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFLVEANPGPGLGIFLAYMFFGKGSSKSTAPGA 252
gi 131498    167 FMVVHDMLPLASIFVEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAKQSAGGA 246
gi 506381185 173 ALVHAHLLPLVSILVEPAKIVFLNNAINHGVFTPLGADQAAHAGQSILYTIESNPGPGIGVLIAYMIFGKGTAKATSYGA 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1709899   253 IIIHFLGGIHEIYFPYVLMRPILILAAIAGGVSGVLTFTIFDAGLVAVPSPGSIFALLAMTPKGNYLGVLAGVLVATAVS 332
gi 790940    253 AIIHFFGGIHEIYFPYILMKPGPDSRSHCRRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVS 332
gi 131498    247 AIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSILAVLAMTPKGAYFANIAGVCAAMAVS 326
gi 506381185 253 GIIQFFGGIHEIYFPYVLMRPLLFVSVILGGMTGVATYSLLDFGFKTPASPGSIIVYAINAPKGEFLHMLTGVVLAALVS 332
                        330
                 ....*....|....*....
gi 1709899   333 FFVASIFLKSAKNNEED-I 350
gi 790940    333 FIVSAVILKSSKASEED-L 350
gi 131498    327 FVVSAILLKTSKVKEEDdI 345
gi 506381185 333 FVVSALILKFTKDPKQDlA 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap