1XGE


Conserved Protein Domain Family
pyrC_dimer

?
TIGR00856: pyrC_dimer 
Click on image for an interactive view with Cn3D
dihydroorotase, homodimeric type
This homodimeric form of dihydroorotase is less common in microbial genomes than a related dihydroorotase that appears in a complex with aspartyltranscarbamoylase or as a homologous domain in multifunctional proteins of pyrimidine biosynthesis in higher eukaryotes. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 129935
View PSSM: TIGR00856
Aligned: 5 rows
Threshold Bit Score: 516.676
Threshold Setting Gi: 3024493
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XGE_A         6 VLKIRRPDDWHLHLRDGDMLKTVVPYTSEI-YGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAghdFTPLMTCYLTDSL 84
gi 1709957     4 EIDLGLTCDMHVHVREGAMCELVTPKIRDGgVSIAYIMPNLQPPITTLDRVIEYKKTLQKLAPK---TTFLMSFYLSKDL 80
gi 2500035     3 KLTITRPDDWHLHLRDGAALKAVLPHTVRQ-FARAIVMPNLKPPVRSVADAAAYRERILAAIPAggqFEPLMTLYLTDNT 81
gi 446048679   7 VLKIRRPDDWHLHLRDGDMLKTVVPYTSEI-YGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAghdFTPLMTCYLTDSL 85
gi 3024493     2 EITLFDPIDAHLHVRENALLKAVLGYSSEP-FSAAVIMPNLSKPLIDTPTTLEYEEEILNHSSN---FKPLMSLYFNDGL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XGE_A        85 DPNELERGFNEgVFTAAXLYPANATTNSSHGVTS--VDAIMPVLERMEKIGMPLLVHGEVTh---Ad---iDIFDREARF 156
gi 1709957    81 TPDLIHEAAQQhAIRGVKCYPAGVTTNSAAGVDPndFSAFYPIFKAMQEENLVLNLHGEKPsvhdGdkepiHVLNAEEAF 160
gi 2500035    82 NPEEIIAAKASqFVKAVKYYPAGATTNSDFGVTD--IHRCDAVLAAMEQVDLPLLLHGEVTd---Sn---iDIFDREKVF 153
gi 446048679  86 DPNELERGFNEgVFTAAKLYPANATTNSSHGVTS--IDAIMPVLERMEKIGMPLLVHGEVTh---Ad---iDIFDREARF 157
gi 3024493    78 TLEELQCAKEK-GVRFLKLYPKGMTTNAQNGTSDllGEKTLEVLENAQKLGFILCIHAEQT----G-----FCLDKEFLC 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XGE_A       157 IEsVMEPLRQRLTALKVVFEHITTKDAADYVRDGNEr--------LAATITPQHLMFNRNHMLVggvRPHLYCLPILKRN 228
gi 1709957   161 LP-ALKKLHNDFPNLKIILEHCTSESAIKTIEDINKnvkkatdvkVAATLTAHHLFLTIDDWAG---NPVNFCKPVAKLP 236
gi 2500035   154 IEkYLIPLREKFPRLRVVLEHITTSDAVQFVLSANN---------IAATITPQHLLFSRNALFKggiCPHFYCLPILKRE 224
gi 446048679 158 IEsVMEPLRQRLTALKVVFEHITTKDAADYVRDGNEr--------LAATITPQHLMFNRNHMLVggvRPHLYCLPILKRN 229
gi 3024493   148 HS-VLETFALSFPKLKIIIEHLSDWRSIALIEKHDN---------LYATLTLHHISMTLDDLLGgslNPHCFCKPLIKTK 217
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XGE_A       229 IHQQALRELVASGFNRVFLGTDSAPHARHRKESSC-GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPV 307
gi 1709957   237 NDKKALVKAAVSGKPYFFFGSDSAPHPVQNKANYEgVCAGVYSQSFAIPYIAQVFEEQNALENLKGFVSDFGISFYEVKD 316
gi 2500035   225 EHRLSLLHAATSGNPKFFLGTDSAPHARNSKESLC-GCAGCYSALHAMELYAEAFESVNSLDKLEAFASFYGPDFYQLPR 303
gi 446048679 230 IHQQALRELVASGFNRVFLGTDSAPHARHRKESSC-GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPV 308
gi 3024493   218 KDQERLLSLALKAHPKISFGSDSAPHFISKKHSAN-IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKTIYGLEN 296
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
1XGE_A       308 n----DTFIELVREEQQVAESIALTD-DTLVPFLAGETVRWSVK 346
gi 1709957   317 sevasSDKAILFKKEQVIPQVISDGKdISIIPFKAGDKLSWSVR 360
gi 2500035   304 n----TAQITLMKNPWRIPAELPFPE-SGLVPLRAGEEITWQMV 342
gi 446048679 309 n----DTFIELVREEQQVAESIALTD-DTLVPFLAGETVRWSVK 347
gi 3024493   297 l---pSKKARLSKKPFMIPTHTLCLN-EKIAILRGGETLSWNLQ 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap