Conserved Protein Domain Family
tal_mycobact

?
TIGR00876: tal_mycobact 
transaldolase, mycobacterial type
This model describes one of three related but easily separable famiiles of known and putative transaldolases. This family and the family typified by E. coli TalA and TalB both contain experimentally verified examples. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 129954
View PSSM: TIGR00876
Aligned: 2 rows
Threshold Bit Score: 525.839
Threshold Setting Gi: 2501348
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226210  14 AGVSVWLDDLSRDRLRSgNLQELIDTKSVVGVTTNPSIFQKALSEGHTYDAQIAELAARgaDVDATIRTVTTDDVRSACD 93
gi 2501348   2 QEFSLWCDFIERDFLEN-DFLKLINKGAICGATSNPSLFCEAITKSAFYKDEIAKLKGK--KAKEIYETLALKDILQASS 78
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226210  94 VLVPQWEDsDGVDGRVSIEVDPRLAHETEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQ 173
gi 2501348  79 ALMPLYEK-DPNNGYISLEIDPFLEDDAAKSIDEAKRLFKTLNRPNVMIKVPASESGIEVVSALTQASIPVNVTLVFSPK 157
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226210 174 RYREVMDAYLTGMEKArqaghslskihSVASFFVSRVDTEIDKRLDRIgsrqaleLRGQAGVANArlayatyrevfedSD 253
gi 2501348 158 IAGEIAQILAKEAQKR-----------AVISVFVSRFDKEIDPLVPKN-------LQAQSGIINA-------------TE 206
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226210 254 RYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPEKTIDAVADHGVIQGDTVTGTAsDAQAVFDQLGA 333
gi 2501348 207 CYYQINQHANKLTSTLFASTGVKSNSLAKDYYIKALCFKNSINTAPLEALNAYLLDPNTECQTPLKTT-EIEAFKKELKV 285
                      330       340       350
               ....*....|....*....|....*....|
gi 6226210 334 IGIDLTDVFAVLEEEGVRKFEASWNELLQE 363
gi 2501348 286 HNIDLENTAQKLLKEGLIAFKQSFEKLLSS 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap