Conserved Protein Domain Family
2A0109

?
TIGR00887: 2A0109 
phosphate:H+ symporter
This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129965
View PSSM: TIGR00887
Aligned: 8 rows
Threshold Bit Score: 725.367
Threshold Setting Gi: 6735503
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529  10 ALDVAKTQLY-------HFTTIVIAGMGFFTDAYDLFCISLVTKLLGRIYY--TepnpTRpGTLPPSAQSAVTGVALVGT 80
gi 2266672  10 ALDVAKTQLY-------HFTAIVIAGMGFFTDAYDLFCISMVTKLLGRLYY--HhdgaLKpGSLPPNVSAAVNGVAFCGT 80
gi 2208908  11 ALDVAKTQWY-------HFTAIVIAGMGFFTDAYDLFCISLVTKLLGRIYY--HvdgaVKpGTLPPNVSAAVNGVAFCGT 81
gi 3724291  38 ALAEIDKAPFgw----yHVRACIVAGVGFFTDSYDIFCVSMLTIMLGIVYYp------GK-GKLPTSSDNAIKLSTSAGT 106
gi 536860   34 ALAEVDRAPFgw----yHVRAVAVAGVGFFTDSYDIFTVSLLTLMLGIVYFq------AK-ARCLQPP---TQPSSSQHR 99
gi 1346710  49 ALESIDDEGFgw----qQVKTISIAGVGFLTDSYDIFAINLGITMMSYVYWh------GS-MPGPSQT--LLKVSTSVGT 115
gi 1132424  17 ALKEIDDAKFgw----qHIRACLVAGTGFFMDAYDLFAVNFASTMIGYVYYg------GK-TPANIDLG--LKVTGSIGT 83
gi 6735503  27 VEEGAQERRYylgltkrEFKLMMLAGVGFFLDSYDLFIINLVTPIFEYLYWggIekgpTGkGHYPSGIRGLVNASANIGN 106
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529  81 LAGQLFFGWLGDKLGRKKVYGLTLILMVVCSVASGLSFG--SSPKSVMATLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 156
gi 2266672  81 LAGQLFFGWLGDKMGRKKVYGMTLMIMVICSIASGLSFG--HTPKGVMTTLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 156
gi 2208908  82 LAGQLFFGWLGDKMGRKRVYGMTLMLMVIASIASGLSFG--DKPKAVMATLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 157
gi 3724291 107 VIGQFGFGMLADIVGRKRMYGLELIVTIFATLAQALTAG--SPSTSLVGLIIFWRVIMGVGIGGDYPLSS--IITSEFAT 182
gi 536860  100 PARSLGRSASAPLLMSLVVRACTDWNCCSSSLPLSLRPW--LRVTFHQHHRYHYLLACSYGGRYRWRLSSfqYITSEFAT 177
gi 1346710 116 VIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAH--SPAINFVAVLTFYRIVMGIGIGGDYPLSS--IITSEFAT 191
gi 1132424  84 LLGQLFFGYLADRLGRKRMYGVELMIIIVATVASALSGE--SRAVTVVGTIMFWRVIMGVGIGGDYPLSA--IITSEFAT 159
gi 6735503 107 IFGQLLFGFMGDFFGRKFVYGKEMVIVIIATVLVIAMPKsiHSPLSKMMWVFCWRWLLGVGIGGDYPMSA--AITSERSK 184
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529 157 KKTRGAFIAAVFAMQGFGILGGGIVALTVASIFDHKYKVPTFEENPAASl-------LVPQFDYVWRLILMFG------- 222
gi 2266672 157 KKTRGAFIAAVFAMQGFGILAGGMVAIIVSAAFKGAFPAPAYEVDAIGS--------TVPQADFVWRIILMFG------- 221
gi 2208908 158 KKTRGAFIAAVFAMQGFGILAGGMVAIIVSASFKAGFPAPAYQDGAVAS--------TVPEADYVWRIILMFG------- 222
gi 3724291 183 TKWRGAMMAAVFAMQGIGQLVAALVMMFLTLGFKSSLEQAADTKSCTGD--------CQIAVDKMWRTLVGFG------- 247
gi 536860  178 TKWRGAMMGAVFAMQGLGQLAAAFVMLFVTLGFKKSLEAAPTLASCTGD--------CAVAVDKMWRTVIGVG------- 242
gi 1346710 192 TKWRGAIMGAVFANQAWGQISGGIIALILVAAYKGELEYANSGAECDAR--------CQKACDQMWRILIGLG------- 256
gi 1132424 160 KKRRGAMMASVFAMQGFGILGSAIVALAVLAGFRN--EIIKDVS----------------AVDYCWRIVLGCG------- 214
gi 6735503 185 IKRRGTLISLIFAFQGFGTLAGAIVTIILLGCFEHPLNREGHYHKLEGVwrlqfglaLVPAIGVLIPRLIMKEsksyens 264
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529 223 -----ALPAALTYYWRMKMPETARYTALVAKNAKQAAADMSKVLQVELEVEEEK------VEKMTSDKR---------NS 282
gi 2266672 222 -----AIPAGLTYYWRMKMPETARYTALVAKNLKQAANDMSKVLQVEIEAEPEK------VTAISEAKGa--------ND 282
gi 2208908 223 -----AIPAALTYYWRMKMPETARYTALVAKNAKQAANDMSKVLQVELEAEQEK------VEKFAQEPA---------NT 282
gi 3724291 248 -----AVPACIALYYRLTIPETPRYTFDVARDVEQADEDVKAYINGKSEGNTDEvtraqnLQSAKTNLEvp-----kaSW 317
gi 536860  243 -----AVPGCIALYYRLTIPETPRYTFDVKRDVEQASDDIEAFKTGKPKGQPDEatrivaKQEAEKEMEip-----kaSW 312
gi 1346710 257 -----TVLGLACLYFRLTIPESPRYQLDVNAKLELAAAAQEQDGEKKIHDTSDEdmaingLERASTAVEsldnhppkaSF 331
gi 1132424 215 -----AVPGLAALYFRLTIPETPRYTMDVEHDVNKATSDITSYLQKNDVNEDD--------TNTGNHVGvp-----kaSW 276
gi 6735503 265 kalnsAEGKDPKAFFNTDDEDNMKKSSSHGDSEVVEASDRYANQADAADAEVDN------IEKQFAAVTtp------eNS 332
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529 283 YGLFSKQFAARHGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMN---AIHEVYKIARAQTLIALCSTVPG 359
gi 2266672 283 FGLFTKEFLRRHGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMN---ALEEVYKIARAQTLIALCSTVPG 359
gi 2208908 283 FGLFTKEFLKRHGLHLLGTATTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMN---AIEEVFRIARAQTLIALCSTVPG 359
gi 3724291 318 RDFFQHYSKWKNASLLLGTAGSWFCLDVAFYGLSLNNGTILKVIGYSTKDATNV----YEFLHNTAVGNIIIVLAGAVPG 393
gi 536860  313 GDFFRHYSKRKNAMLLAGTALSWCFLDIAYYGVSLNNATILNVIGYSTTGAKNT----YEILYNTAVGNLIIVLAGAVPG 388
gi 1346710 332 KDFCRHFGQWKYGKILLGTAGSWFTLDVAFYGLSLNSAVILQTIGY--AGSKNV----YKKLYDTAVGNLILICAGSLPG 405
gi 1132424 277 SDFVSYFGKWSNGKVLLGTSMSWFALDIAFYGIGLNNGIILSAIGYSETHEADLnlrAYNSLKNMAVGNIIITIMGTAPG 356
gi 6735503 333 SGFITYFRQWRHFKHLLGTSVCWFLLDIAFYGVNLNQSVILKNIGFS---TGTN---EYRTLMKNAIGNLIIAVAGYVPG 406
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2465529 360 YWFTVAFIDHMGRFAIQMMGFFFMTVFMFALAIPYDHWSKEenriGFVVIYSLTFFFANFGPNATTFVVPAEIFPARLRS 439
gi 2266672 360 YWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKdhriGFVVMYSFTFFFANFGPNATTFVVPAEIFPARLRS 439
gi 2208908 360 YWFTVFLIDRIGRFIIQWMGFFFMTVFMFALAIPYNHWTHKdnriGFVIMYSLTFFFANFGPNATTFVVPAEIFPARLRS 439
gi 3724291 394 YWVSVATIDTLGRKTIQLGGFIILTILFIVMGFAYNHIPSN----GLLAIYVLAQFFFNFGPNTTTFIVPGEVFPTRYRS 469
gi 536860  389 YWVTVFTVDTVGRKPIQFMGFGILTILFVVMGFAYKHLSPH----ALLAIFVLAQFFFNFGPNATTFIVPGEVFPTRYRS 464
gi 1346710 406 YWVSVFTVDIIGRKPIQLAGFIILTALFCVIGFAYHKLGDH----GLLALYVICQFFQNFGPNTTTFIVPGECFPTRYRS 481
gi 1132424 357 YWVTAALVDSWGRKPIQLMGFGVLTALFIVMGAAFNPLKEHsi-pAFIILFTLLQFFQNFGPNTTTFIVPGEVFPTRYRS 435
gi 6735503 407 YWFNVFLVEILGRKWIQLQGFVITGLMFAILAGRWNEISTG----GRFACFVIAQLFSNFGPNSTTFIYPAEVFPARVRG 482
                      490       500       510       520       530       540       550
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2465529 440 TCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKtdkGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSLEELSGE 517
gi 2266672 440 TCHGISAAAGKAGAMVGAFGFLYAAQPTDPTKtdaGYPPGHWCEELVDRPWLCNFLGMLFTFLVPESNGKSLEDLSRE 517
gi 2208908 440 TCHGISAAAGKAGAIIGAFGFLYAAQPSDPSKtdkGYPPGIGVKNALIVLGCVNFLGMVFTFLVPEAKGKSLEEVSKE 517
gi 3724291 470 TSHGISAASGKIGSIIGQGAISILRTHGATDK----NEA-PWMDHVLEIYALFMLLGIFTTLLIPETARKTLEELSGE 542
gi 536860  465 TSHGLSAAMGKIGSIIGQGAIAPLRTRGAVKG---GNPN-PWMNHVLEIYALFMLLGVGTTFLIPETKRKTLEELSGE 538
gi 1346710 482 TAHGISAASGKVGAIIAQTALGTLIDHNCARD---GKPTNCWLPHVMEIFALFMLLGIFTTLLIPETKRKTLEEIN-E 555
gi 1132424 436 TGHGISAASGKLGAIVAQVGFSKLKDIGGSN---------AFVGPLLLIFSAWMFIGGLFSILIPETKGLSLEELANE 504
gi 6735503 483 TAHGVSAALGKCGAILASLLFNFLTG-------------VIGYGNVMWIFCGCMWGGILFTLLLPETKGRDADEIDRL 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap