1GPM,2LXN


Conserved Protein Domain Family
guaA_Nterm

?
TIGR00888: guaA_Nterm 
Click on image for an interactive view with Cn3D
GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit
This protein of purine de novo biosynthesis is well-conserved. However, it appears to split into two separate polypeptide chains in most of the Archaea. This N-terminal region would be the smaller subunit. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 129966
View PSSM: TIGR00888
Aligned: 14 rows
Threshold Bit Score: 294.222
Threshold Setting Gi: 13627227
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GPM_A        10 ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNP--SGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCY 87
gi 1346218    29 IVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKP--KGIILSGGPNSVYDQGAPECDPEIFQLGVPVLGVCY 106
gi 3122166     2 ILVLDFGSQYTQLIARRLRERGIYTEIVPFFESIENIQKKAP--KGLILSGGPASVYAKDAYKPSGKIFDLNVPILGICY 79
gi 6225492     6 ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNP--YGIIFSGGPASVYAEGAPLPDKRIYELGVPILGICY 83
gi 854469     14 ILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKISELG-WTP--KGVILSGGPYSVYAEDAPHVDHAIFDLNVPILGICY 90
gi 13627227   10 VLVVDFGGQYAHLIARRIRELGVYSEIVPATS-LDALGEALPraAGVVLSGGPGSVWGSRHDEAAAMVLQLGKPVLGICY 88
gi 2494764    17 VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQP--VALVLSGGPASVYADGAPKLDPALLDLGVPVLGICY 94
gi 497654646   9 ILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNP--KGIILSGGPNSVYDENSFRCDEKIFELDIPVLGICY 86
gi 499187895   3 IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNP--KGIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICL 80
gi 499178808   4 ILIINNHGQYNHRIHRTLRYLQIPSELVPNTTPLDEIISRDP--EGLILGGGPSLERSGNCVEYIQK---LEIPILGICL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GPM_A        88 GMQTMAMQLGGHVEASNEREFGYAQVEVVNDS-ALVRGIEDaltadgkpLLDVWMSHGDKVTAIPSDFITVASTE-SCPF 165
gi 1346218   107 GMQLMVKQLGGRVERAKRGEYGKASLHIDDPT-DLLTNVEN--------DSTMWMSHGDSCVDLPTGFEILAHTD-NTPC 176
gi 3122166    80 GMQYLVDFFGGVVVGANEQEFGKAVLEITQNS-VIFEGVKI--------KSLVWMSHMDKVIELPKGFTTLAKSP-NSPH 149
gi 6225492    84 GLQVITHQLGGKVVRSEKQEYGRARLRIIKED-VIFEGIPK--------ESDVWMSHADKVVELPEGFEVLAVSE-NSPY 153
gi 854469     91 GMQELAWINGKQVGRGDKREYGPATLKVIDDSnSLFKGMN---------DSTVWMSHGDKLHGLPTGYKTIATSD-NSPY 160
gi 13627227   89 GHQLLAKVLGGEVGRSPLPEFGPTEVEVLDYG-ILLNGLPS--------RFKVWMSHYDAVLRPPGEAKVLARTP-GSPV 158
gi 2494764    95 GFQAMAQALGGIVAHTGTREYGRTELKVLG-G-KLHSDLPE--------VQPVWMSHGDAVTAAPDGFDVVASSA-GAPV 163
gi 497654646  87 GMQLMTHYLGGKVEAASQREYGKANIRIEGTP-DLFRDLPN--------EQVVWMSHGDLVVEVPEGFTVDAATShHCPN 157
gi 499187895  81 GHQLIAKFFGGKVGRGEKAEYSLVEIEIIDED-EIFKGLPK--------RLKVWESHMDEVKELPPKFKILARSE-TCPI 150
gi 499178808  79 GHQLIAKAYGGEVATAEAESYAQIELEILDED-DIFRGLGP--------RMSVWASHKDEVKKLPDEFDVLATSS-ICEV 148
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
1GPM_A       166 AIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCE 205
gi 1346218   177 AAIADHQKALFGVQFHPEVVHSVGGIALIRNFVYHICHCE 216
gi 3122166   150 CAIENG--KIFGLQFHPEVVQSEEGGKILENFALLVCGCE 187
gi 6225492   154 AVIANREKKIYGFQFHPEVTHTVFGKEMLANFIYGVCKAE 193
gi 854469    161 CGIVHETKPIYGIQFHPEVTHSTQGKTLLKNFAVDLCHAK 200
gi 13627227  159 AAMELWG-RVFGVQWHPEVRHTQYGREVLDNWLS-LVGAP 196
gi 2494764   164 AAFEAFDRRLAGVQYHPEVMHTPHGQQVLSRFLHDFAGLG 203
gi 497654646 158 SAMSKADKKWYGVQFHPEVRHSEYGNDLLKNFVFGVCECE 197
gi 499187895 151 EAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAK-LCGel 189
gi 499178808 149 EAMKHHDKPVYGIQFHPEVHHTREGHRVFENF-YDVCRS- 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap