Conserved Protein Domain Family
2A0110

?
TIGR00889: 2A0110 
nucleoside transporter
This family of proteins transports nucleosides at a high affinity. The transport mechanism is driven by proton motive force. This family includes nucleoside permease NupG and xanthosine permease from E.Coli. [Transport and binding proteins, Nucleosides, purines and pyrimidines]
Statistics
?
PSSM-Id: 129967
View PSSM: TIGR00889
Aligned: 3 rows
Threshold Bit Score: 535.607
Threshold Setting Gi: 3025166
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507157     1 MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLhFTGANVGMVYSSKGIAAIIMPGIMGIIADKWLRAERAYMLCHLVCA 80
gi 3025166     1 MKTTAKLSFMMFVEWFIWGAWFVPLWLWLSKSG-FSAGEIGWSYACTAIAAILSPILVGSITDRFFSAQKVLAVLMFAGA 79
gi 446255686  17 MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLkFDGASIGAVYSSLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507157    81 GVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSCLAqaglDPVTAFPPIRVFGTVGFIVAMWAVSLL------- 153
gi 3025166    80 LLMYFAAQQTTFAGFFPLLLAYSLTYMPTIALTNSIAFANVP----DVERDFPRIRVMGTIGWIASGLACGFLpqilgya 155
gi 446255686  97 ITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYRLQnagmDIVTDFPPIRIWGTIGFIMAMWVVSLS------- 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507157   154 HLELSSLQLYIASGASLLLSAYALTLPKIPvAEKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNP 233
gi 3025166   156 DISPTNIPLLITAGSSALLGVFAFFLPDTP-PKSTGKMDIKVMLGLDALILLRDKNFLVFFFCSFLFAMPLAFYYIFANG 234
gi 446255686 170 GFELSHMQLYIGAALSAILVLFTLTLPHIPvAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNT 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507157   234 FLHDFArnpefadsfvVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFAYG-DPSTTGFILLL 312
gi 3025166   235 YLTEVG----------MKNATGWMTLGQFSEIFFMLALPFFTKRFGIKKVLLLGLVTAAIRYGFFIYGsADEYFTYALLF 304
gi 446255686 250 FLHSFDkdpmfassfiVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAYG-DPTPFGTVLLV 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507157   313 LSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAWVGSILSGMAVDYFSVDG------VKDWQTIWLV 386
gi 3025166   305 LGILLHGVSYDFYYVTAYIYVDKKAPVHMRTAAQGLITLCCQGFGSLLGYRLGGVMMEKMFAYQepvnglTFNWSGMWTF 384
gi 446255686 329 LSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNG------ITDWQTVWLI 402
                        410       420       430
                 ....*....|....*....|....*....|....*
gi 2507157   387 FAGYALFLAVIFFFGFKYNHD---PEKIKHRAVTH 418
gi 3025166   385 GAVMIAIIAVLFMIFFRESDNeitAIKVDDRDIAL 419
gi 446255686 403 FAGYSVVLAFAFMAMFKYKHV---RVPTGTQTVSH 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap