Conserved Protein Domain Family
2A0127

?
TIGR00902: 2A0127 
phenyl proprionate permease family protein
This family of proteins is involved in the uptake of 3-phenylpropionic acid. This uptake mechanism is for the metabolism of phenylpropanoid compounds and plays an important role in the natural degradative cycle of these aromatic molecules. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129980
View PSSM: TIGR00902
Aligned: 2 rows
Threshold Bit Score: 537.592
Threshold Setting Gi: 2495642
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175216   1 MQVRPFYWLALSFLGYYCAYGVFLPFFPAWLKSQQYGEEMIGLVIGSAYIFRFAGGLFFSSLIKKANHIIIALRLLALAS 80
gi 2495642   1 MVLQSTRWLALGYFTYFFSYGIFLPFWSVWLKGIGLTPETIGLLLGAGLVARFLGSLLIAPRVSDPSRLISALRVLALLT 80
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175216  81 AIIMAAMSLVAHNFWLLFIAIGlYASVNSAGMPIGDSLASTWQRQIGLDYGKVRLIGSAAFILGVVVFGGMIGWVGEQNI 160
gi 2495642  81 LLFAVAFWAGAHVAWLMLVMIG-FNLFFSPLVPLTDALANTWQKQFPLDYGKVRLWGSVAFVIGSALTGKLVTMFDYRVI 159
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175216 161 VWILTALLSFYTIIQLLKPTIPPKDEIPEDSVQNDVGFIALLKnpMTLRVMIAVGLIQGSHAAYYVYSTIYWTSIGISVS 240
gi 2495642 160 LALLTLGVASMLLGFLIRPTIQPQGASRQQESTGWSAWLALVR--QNWRFLACVCLLQGAHAAYYGFSAIYWQAAGYSAS 237
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175216 241 QTSLLWGIGVLAEIVLFFFSRRLFQNISISVLLYISALACVGRWAVIGYIEDFWLIFLLQLMHSLTYAVCHYAIVRYITT 320
gi 2495642 238 AVGYLWSLGVVAEVIIFALSNKLFRRCSARDMLLISAICGVVRWGIMGATTALPWLIVVQILHCGTFTVCHLAAMRYIAA 317
                      330       340       350       360       370       380
               ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1175216 321 QPQSHIAKLQGLYNGLSNGVLIAIFTAIAGMIYPTSPAMTFVFMSIIAAAAFFVIPRKLNAF 382
gi 2495642 318 RQGSEVIRLQAVYSAVAMGGSIAIMTVFAGFLYQYLGHGVFWVMALVALPAMFLRPKVVPSC 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap