Conserved Protein Domain Family
2A0129

?
TIGR00903: 2A0129 
major facilitator 4 family protein
This family of proteins are uncharacterized proteins from archaea. This family includes proteins from Archaeoglobus fulgidus and Aeropyrum pernix. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129981
View PSSM: TIGR00903
Aligned: 2 rows
Threshold Bit Score: 491.764
Threshold Setting Gi: 118431805
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499168625  15 FSSQAIWVTYSPVTSLVAEDLDVSKEEVGLLAIVYPAAFLALTIPSGVLLDRAFRTWLTVGVLLTGAAGVLRLLDpLSYE 94
gi 499182243  17 FASQAVWVTFSPVLTLVSEEINVSVELLGLLAVTYPIFFLILTIPSGLLLDRDFKRWFLFGSVATFFAAAGRLVS-FNYY 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499168625  95 WLLACQVLAALGQPLLLNSFAPAASTIRPERRDTVVSLLSFAMYLGIIYALGTGYYIYTRLGLQWLNIPIAAVSAASVIL 174
gi 499182243  96 WLLVCQLSGALGQPFLLNAFVPYASQLYEERRTLVISVLSLSMYLGTVFALAAGLKLYTAGGLTLLILPSAVVATAGIVL 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499168625 175 YVAGLPALPQQAGSGLgfkdVVSEFRLLAGRRDLWLLGLILGLGVALFDNMSIWLEAALSPKGLGDIAGSSVALALLAGL 254
gi 499182243 176 VLIAVRAVRFTKAESF----AVKQFGAVLKRKDLWIIGAILGFGVATFDNLATWLQPALRSAGLEKVAGDAVALAIVLGL 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499168625 255 VGVAVIPPRVVRVGLRSWYIRAAALLVAVLYLALALETSRLAVQTLIPLAGLVMLPAYPVIMEWISTYYDKRLQGKAAGA 334
gi 499182243 252 IGVAVIPDRVARANLRTIYMRSITPLIAAFFVILAFSLNTTLLFAFLGISGLLMLPAYAIIMDWIGKFCDREVHGSATGF 331
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 499168625 335 IGFVSRILTVSLASAATLFLSSPSAYFTFLAVLSTIAFAIALLLPSDR 382
gi 499182243 332 VGLTSRAISVALTLGAMYFISSAELYFTYLTIPITVAFILTLLLPNDR 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap