Conserved Protein Domain Family
mreB

?
TIGR00904: mreB 
cell shape determining protein, MreB/Mrl family
MreB (mecillinam resistance) in E. coli (also called envB) and the paralogous pair MreB and Mrl of Bacillus subtilis have all been shown to help determine cell shape. This protein is present in a wide variety of bacteria, including spirochetes, but is missing from the Mycoplasmas and from Gram-positive cocci. Most completed bacterial genomes have a single member of this family. In some species it is an essential gene. A close homolog is found in the Archaeon Methanobacterium thermoautotrophicum, and a more distant homolog in Archaeoglobus fulgidus. The family is related to cell division protein FtsA and heat shock protein DnaK. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 129982
View PSSM: TIGR00904
Aligned: 9 rows
Threshold Bit Score: 533.91
Threshold Setting Gi: 15606197
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1572983    37 FSNDLSIDLGTANTLIYVKRQGIVLDEPSVVAIRQDR-VGTLKSIAAVGKEAKLMLGRTPKSIVAIRPMKDGVIADFFVT 115
gi 486298106  34 FSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR-AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVT 112
gi 497915165  32 FSGNVGIDLGTANTLVYVRGRGIVLSEPSVVAV-----DAQTHAVLAVGHKAKAMLGKTPRKIVAVRPMKDGVIADFEIA 106
gi 490734632   9 FSSGMAIDLGTANTIVYQKSRGIVLREPSVIALIKKD-GAFVP--YAYGHEAKMMLGRTPTDIEAKRPLKDGVIADFKGA 85
gi 488620572   7 FLIDIGIDLGTCNTLVYIKDYGVVMSEPSVVAIDITK-G---NKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENT 82
gi 499184406   7 FSADVGIDLGTCNTIIYVEGRGIVVNEPSVVAVERG-----TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTT 81
gi 142855      5 GARDLGIDLGTANTLVFVKGKGIVVREPSVVALQTD-----TKSIVAVGNDAKNMIGRTPGNVVALRPMKDGVIADYETT 79
gi 446499911  10 FSHDIAIDLGTANTIVLVKGQGIIINEPSIVAVRMGLfDSKAYDILAVGSEAKEMLGKTPNSIRAIRPMKDGVIADYDIT 89
gi 499182972  10 FSSNIGIDLGTANTAVFVEGKGIVLYEPSIVAIDTK-----SKKILAVGKEAKEMVGKTPENIQAIRPLRHGVISDFEVT 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1572983   116 EKMLQYFIKQVHSG-N-FM--RPspR--VLVCVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAKLPVSTAVGS 189
gi 486298106 113 EKMLQHFIKQVHSN-S-FM--RPspR--VLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGS 186
gi 497915165 107 EGMLKALIKRVTPArS-MF--RP--K--ILIAVPSGITGVEKRAVEDSALHAGAQEVILIEEPMAAAIGVDLPVHEPAAS 179
gi 490734632  86 EEMIKYFIKMVHNRrS-FF--GP--T--IVICVPSGSTPVERRAIQEAAESAGGRDVYLIEEPMAAAIGAGLPVTEATGS 158
gi 488620572  83 EKMIKYFINQIFSRkKlFF--KP--R--MVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGH 156
gi 499184406  82 EKMIRYFISKILPRhR-LI--KP--R--MVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGN 154
gi 142855     80 ATMMKYYINQAIKNkG-MFtrKP--Y--VMVCVPSGITAVEERAVIDATRQAGARDAYPIEEPFAAAIGANLPVWEPTGS 154
gi 446499911  90 AKMIRYFIEKVHKRkT-WI--RP--R--IMVCVPYGLTSVERNAVKESTLSAGAREVFLIEEPMAAAIGAGLPVKEPQGS 162
gi 499182972  85 QAMLTYFIKKVLGR-S-IL--KP--KpiTVIGVPTGITPVEKRAVVDAAKSAGAREVYLVAEPMAAAIGAGLPVEEPIGN 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1572983   190 MVIDIGGGTTEVAVISLNGIVYSSSVRIGGDRFDEAIISYVRRTFGSVIGEPTAERIKQEIGSAYIq-eGDEIKEMEVHG 268
gi 486298106 187 MVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYP---GDEVREIEVRG 263
gi 497915165 180 MIIDIGGGTTEIAIISLGGIVESRSLRIAGDEFDECIINYMRRTYNLMIGPRTAEEIKITIGSAYPl--GDQELEMEVRG 257
gi 490734632 159 MIVDIGGGTTEVAVLSLGGIVYARSVRVGGDKMDEAIISYIRRHYNLLIGEATAEKIKQEIGTAYVd-eNAEPRKMEIKG 237
gi 488620572 157 MVCDIGGGTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGNVYPdiqNLRVEKIDIKG 236
gi 499184406 155 MVCDIGGGTTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGNASPe-kN--IEKVEVKG 231
gi 142855    155 MVVDIGGGTTEVAIISLGGIVTSQSIRVAGDEMDDAIINYIRKTYNLMIGDRTAEAIKMEIGSAEAp---EESDNMEIRG 231
gi 446499911 163 LIVDIGGGTTEIGVISLGGLVISKSIRVAGDKLDQSIVEYIRKKFNLLIGERTGEEIKIEIGCAIKl---DPPLTMEVSG 239
gi 499182972 159 MIVDIGGGTTDIAVISLAGIVVSNSLRVAGDEMNEAIIQYIKRKLHLLIGEQTAERIKIELGSAIMe---EEERQMEIRG 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1572983   269 HNLAEGAPRSFTLTSRDVLEAIQQPLNGIVAAVRTALEECQPEHAADIFERGMVLTGGGALLRNIDILLSKESGVPVIIA 348
gi 486298106 264 RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVA 343
gi 497915165 258 RDQVAGLPITKRINSVEIRECLAEPIQQIIECVRLTLEKCPPELSADLVERGMVLAGGGALIKGLDKALSKNTGLSVITA 337
gi 490734632 238 RDLIYGIPKEMILNERQIADSLIEPVSQIVEAVKVALEATPPELSSDIVDKGIVLTGGGSLLRNLDFVLSEATKLPVIVA 317
gi 488620572 237 TDAVTGLPRKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVA 316
gi 499184406 232 TDAITGLPRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILA 311
gi 142855    232 RDLLTGLPKTIEITGKEISNALRDTVSTIVEAVKSTLEKTPPELAADIMDRGIVLTGGGALLRNLDKVISEETKMPVLIA 311
gi 446499911 240 RDQVSGLLHTIELSSDDVFEAIKDQVREISSALRSVLEEVKPDLAKDIVQNGVVLTGGGALIKGLDKYLSDMVKLPVYVG 319
gi 499182972 236 RD-MTGLPRTETITNHMVTEALEETVNSIVNAVRTTLEKTPPELASDIAERGIVLAGGGSLLRNLDKKIEQETGIKARYA 314
                        330       340
                 ....*....|....*....|...
gi 1572983   349 EDPLTCVARGGGEALEMIDMHGG 371
gi 486298106 344 EDPLTCVARGGGKALEMIDMHGG 366
gi 497915165 338 PHPLLAVCLGTGKALEHLDQLKK 360
gi 490734632 318 DDALSCVALGTGKVLEDFTKLKH 340
gi 488620572 317 DNPLLSVAVGAGLFYDYANRIDI 339
gi 499184406 312 ENPMNCVAIGAGRYHEVYKDISG 334
gi 142855    312 EDPLDCVAIGTGKALEHIHLFKG 334
gi 446499911 320 DEPLLAVAKGTGEAIQDLDLLSR 342
gi 499182972 315 DEPLTSVAKGLGMVLENIDLIRR 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap