Conserved Protein Domain Family
2A0307_GadC

?
TIGR00910: 2A0307_GadC 
glutamate:gamma-aminobutyrate antiporter
Lowered cutoffs from 1000/500 to 800/300, promoted from subfamily to equivalog, and put into a Genome Property DHH 9/1/2009 [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129988
View PSSM: TIGR00910
Aligned: 2 rows
Threshold Bit Score: 809.132
Threshold Setting Gi: 18202004
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725    8 GKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWVSNTLGPRW 87
gi 18202004   1 MNQKKLSLFGFFALTASMVLTVYEYPTFATSKLHLVFFLLLGGLLWFLPVALCAAEMATVEGWKNGGIFSWVSQTLGERF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725   88 GFAAISFGYLQIAIGFIPMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAGILLP 167
gi 18202004  81 GFAAIFFQWFQITVGFVTMIYFILGALSYVLNFQALNTDPLIKFIGLLIIFWGLTFSQLGGTQRTAKLVKAGFVVGIVIP 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725  168 AFILIALAAIYLHSGAPVAIEMDSKTFFPDFSKVGTLVVFVAFIGSYMGVEASATHVNEMSNPGRDYPLAMLLLMVAAIC 247
gi 18202004 161 SVILFGLAAAYFIGGNPIEIPINSHAFVPDFSQVSTLVVFVSFILAYMGVEASASHINELENPKRNYPLAMILLVILAIS 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725  248 LSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPA 327
gi 18202004 241 LDAIGGFSVAAVIPQKELSLSAGVIQTFQTLILHFNHHLGWLVKVIALMIAFGVMGEVSSWVVGPSRGMFAAAQRGLLPK 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725  328 AFAKMNKNGVPVTLVISQLVITSIALIILTNTGGGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPG 407
gi 18202004 321 FLRKTNTHEVPVPLVMIQGIIVTLWGAVLTFGGGGNNLSFLVAISLTVVIYLVGYLLFFIVYFVLIYKKQNLKRTYNVPG 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4262725  408 GKGVKLVVAIVGLLTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDRKGKAntgvTLEPINSQNA 487
gi 18202004 401 KIIGKTIIAGIGFLLSIFALFISFVPPASIAKNETHTYQMILLISFVVTAILPFIIYELHDKKGHD----TIEEPTHFKA 476
                       490       500
                ....*....|....*....|....*..
gi 4262725  488 PKGHFFLHPRARSPHYIVMNDK---KH 511
gi 18202004 477 GDVNPAIYPAARGEHHIIKKEEhilKH 503
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap