Conserved Protein Domain Family
2a38euk

?
TIGR00934: 2a38euk 
potassium uptake protein, Trk family
The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and wheat. The proteins of E. coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterized.The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. This family is specific for the eukaryotic Trk system. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130009
View PSSM: TIGR00934
Aligned: 8 rows
Threshold Bit Score: 419.388
Threshold Setting Gi: 3695407
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230     3 IRGTMSRVPTLASFEVRyk--kSFGHKFRDFIALCGHYCSPIKKYIFPNFIAVHYFYTIVLT-LITSILLYP---VKNIR 76
gi 136231     3 FRRTMSRVPTLASLEIRyk--kSFGHKFRDFIALCGHYFAPVKKYIFPSFIAVHYFYTISLT-LITSILLYP---IKNTR 76
gi 136232     4 AKRTSSRASLALPFQLRlvhkkSWGHRLRDFISGFLKSCRPIAKYVFPNFIVVHYIYLITLS-IIGSILLYP---CKNTA 79
gi 4809179    2 IFRKVVRNPTVQNIQIYr---kTLGHQIRDIIEKLTKKIDPFVKFIFPNFIAFHYFYIIAFA-LLCSILIYP---VKNFA 74
gi 3724137    1 ----MERLRSITQEK------------WAWICHHIGFRPRKLMTEGHFQYQTVHYTLIIGLT-IVGSILIYAs-hRGQVA 62
gi 1717749    1 --------------------------MVLNYIQRWFKWVIPTFG-----FLAIHYIYIISLT-IIASILLFTggtTTKIK 48
gi 567062     1 MGRVKRFYQDFIHIKLH-----SFCRISGYVVDSIAFVYRFVALHVHPFWIQLSYFLAIAILgSVLLMSLKPsnpDFSPP 75
gi 3695407    1 ------------MDR---------------VVAKIAKIRSQLTKLRSLFFLYFIYFLFFSFLgFLALKITKPrttSR-PH 52
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230    77 YIDALFLAAGAVTQGGLNTVDVNNLTLYQQIILYIICCISTPIAVHSCLAFVRLYWFERYFDGIRDSSRLNF-KMRRTKT 155
gi 136231    77 YIDTLFLAAGAVTQGGLNTVDINNLSLYQQIVLYIVCCISTPIAVHSCLAFVRLYWFERYFDGIRDSSRRNF-KMRRTKT 155
gi 136232    80 FIDVLFLAAGASTQGGLATKSTNDFNLYQQIVVYVITLLSTPILIHGFLAFVRLYWFERYFDNIRDISKQNF-KLRRTMT 158
gi 4809179   75 YIDILFLATGAATQGGLNTVDLNELSLYQQIVLYITTALTTPIFIHSGLAFVRFYWFERYFDGIRDWSKRDF-EMRRTMT 153
gi 3724137   63 YVDALFFAAGACTQGGLNTIDVNLINTFSQAVIFLLAMLTNPISIGYYTVSLRRYWFEKKLQTIVQDAKQRRgTISKSKS 142
gi 1717749   49 YIDALFLASSATTQTGLNSVDLNSLSIWQQFILYGFTAITVPIWMHGSISFIRLYWFRRKFKDVVRQNRTRK-FQRKLRK 127
gi 567062    76 YIDMLFLSTSALTVSGLSTITMEDLSSSQIVVLTLLMLIGGEIFVS---------------------------LLGLMLR 128
gi 3695407   53 DFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTS---------------------------FLNLYVS 105
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   156 ILERELTARTMTKSKTGgt-------qrVSRPGKSDKRDDFQEKLFNGEMVNRDEqdsvhSSHNSRDSNsnantnssnnn 228
gi 136231   156 ILERELTARTMTKNRTGtq--------rTSYPRKQAKTDDFQEKLFSGEMVNRDEqdsvhSDQNSHDISrdssnnntnhn 227
gi 136232   159 LQQRELSG---S---SG-----------N-----AARSRSFKDNLFRGKFVSRED-----PRQSASDVPmd--------- 202
gi 4809179  154 LRQRELTKNNTMENASRstgqgplnfltRTFTHGDRDASNFQGRLFRGEVVKRDE-------DNNDDSS----------- 215
gi 3724137  143 QMRTDFLSQAERGVAGRe----------ITVMHGSGSPRMTNDGILLGSFQKPTYdsrapPDQRDPDQP----------- 201
gi 1717749  128 SLMKKSEDDEEQGVRGRki--------rVMLPYLHSLRSPTSLKNFS-RFDTHDStnnpyFPDNPPSPK----------- 187
gi 567062   129 VNHQDMQDLP--------------------------------------------------------SVK----------- 141
gi 3695407  106 YFTNSIEDR----------------------------------------------------------------------- 114
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   229 sinhngssgslddyvredkadevekyhgnksyssvgssSNTATDENISqklkpsslrfdesqnKRKrtgapSEKFAKRRG 308
gi 136231   228 gssgslddfvk-----edetddngeyqennsystvgssSNTVADESLNqkpkpsslrfdephsKQRparvpSEKFAKRRG 302
gi 136232   203 -------------------------------------sPDTSALSSISplnvs------sskeESSdtqssPPNFSSKRQ 239
gi 4809179  216 --------------------------------------VDTRPPEAHS---------------DHT------EKFIGRRK 236
gi 3724137  202 --------------------------------------EDTRRQPEIR-----------------------FAGTVKKSD 220
gi 1717749  188 --------------------------------------ADISKDEYFGkylpkk---sdtldmDLEshnmtFHDYEPSIE 226
gi 567062   142 ----------------------------------------------IS-------------------------------- 143
gi 3695407      --------------------------------------------------------------------------------
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   309 SRDITPEDMYRSIMMLQGEHEgtaedegpplvigsptdgtrnmdngsesksaptmneskiRIQDKgakisldqdsvlHSS 388
gi 136231   303 SRDISPADMYRSIMMLQGKHEataedegpplvigspadgtryksnvnklkkatgingnkiKIRDKgnesntdqnsvsSEA 382
gi 136232   240 PSDVDPRDIYKSIMMLQ-------------------------------------------KQQEK------------SNA 264
gi 4809179  237 SRDINPADMYRSIAMLQNRHEsndnikgp------------------------alvikspAEREKe----------iEEQ 282
gi 3724137  221 GLGLDAIKLPRSDEEHIAILE----------------------------------------------------------- 241
gi 1717749  227 NKNYDFGSSHSASMQMYEMDDlh------------------------------------pRLRRQss--------fiSSV 262
gi 567062   144 SVPVELEELDLPNSMAL--------------------------------------------------------------- 160
gi 3695407      --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   389 NSsacTSDEDSlptnfggttpslsakpreSSSgpiaftegenadrkqgpsiqfnitkpprkaskskrvstmddlnprsif 468
gi 136231   383 NStasVSDESSlhtnfgnkvpslrtnthrSNSgpiaitdnaetdkkhgpsiqfditkpprkiskr--vstfddlnpkssv 460
gi 136232   265 NS----TDSFS------------------SETngp--------------------------------------------- 277
gi 4809179  283 RRlqkEREEQQ------------------GQS------------------------------------------------ 296
gi 3724137  242 -----RQRNR---------------------------------------------------------------------- 246
gi 1717749  263 NPleaDDTRETl-----------------SEGa----------------------------------------------- 278
gi 567062       --------------------------------------------------------------------------------
gi 3695407      --------------------------------------------------------------------------------
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   469 phqkksskgyimkhlpkarrIRQQIKRRLSTGSIDKNSssdaldrglisglnddddgnegdnmeeyfad----nesgded 544
gi 136231   461 lyrkkaskkylmkhfpkarrIRQQIKRRLSTGSIEKNSsnnvsdrkpitdmddddddddndgdnneeyfadnesgdeder 540
gi 136232   278 -----------------afiVQERHERRAPHCSLKRHSvlp--------------------------------------- 301
gi 4809179  297 --------------------IQFKVEPRPTKSTRSTFEps---------------------------------------- 316
gi 3724137  247 ---------------------DDEVLRIPGPRDMERG------------------------------------------- 262
gi 1717749  279 -------------------lVQESLPMAYSYSDTNLVVs----------------------------------------- 298
gi 567062       --------------------------------------------------------------------------------
gi 3695407      --------------------------------------------------------------------------------
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   545 drmqqsepqsgselklkqqqqhqlQqNLHRMYKTKSFDdnrsKPVLMERSKTIDMAEARDLNELARTPDFQKMVYKNWKA 624
gi 136231   541 vqqsephsdselkshqqqqekhqlQqNLHRMYKTKSFDdnrsRAVPMERSRTIDMAEAKDLNELARTPDFQKMVYQNWKA 620
gi 136232   302 ----------------------ssQ-ELNKLAQTKSFQ----KLLGLRR-------DEGDHDYFDGAP-HKYMVTK---- 342
gi 4809179  317 ----------------------giRkSFTRRKRPSFFKg--sQSARIIRDKLRRRSKGSDVNNVDDEEEEQDGHDADMEG 372
gi 3724137  263 --------------------------AKPRRVDDSAEEddrePAQRAPMVTLNGRAQAITIEEPDRNKLYETLTEDFVDD 316
gi 1717749  299 ------------------------RdSFTLTGDDNLFP----E-GGLRPANTIDGIVRSSLSSSSLSKDTEPSTVDMHIA 349
gi 567062   161 ----------------------------------------------------------CDESQLEEAA------------ 170
gi 3695407  115 ----------------------------------------------------------CDVETVTDYR------------ 124
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   625 HHRNKPNFKRRGWNGKMFEHGPYTSDSDHNYQDNGNnsnsivhyaesilHRDNSHRNGSEDVSSDSNEttyplngnndhs 704
gi 136231   621 HHRKKPNFRKRGWNNKIFEHGPYASDSDRNYPDNSNtgnsilhyaesilHHDGSHKNGSEEASSDSNEniystng--gsd 698
gi 136232   343 ---KKKISRTQSCNIPTYTASPSPKTSGQVVENHRNl------------AKSAPSSFVDEEMSFSPQEsln--------- 398
gi 4809179  373 SSEDDSVIESSDGQSESISAPNFDHHSSEPTLQSGG-------------TVSAPSSLESNEIEEEDEEls---------- 429
gi 3724137  317 AKMFTHSFVPQLNHLKFRKNTRAPTRNRGDEEADP--------------KLQRSNSRMSRRPSLSAMR------------ 370
gi 1717749  350 FTGLNKPTIERERNLKLRKKSRFYKKSLRSRFSRGLh-----------rPIRWTKSFTSNRRNLTLER------------ 406
gi 567062       --------------------------------------------------------------------------------
gi 3695407      --------------------------------------------------------------------------------
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   705 qndaNGYPTYNDEEEgyyglhfdsdynlDPHHALSSNASKNYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTI 784
gi 136231   699 hnglNNYPTYNDDEEgyyglhfdtdydlDPRHDLSKGSGKTYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTI 778
gi 136232   399 -lqfQAHPPKPKRREg------------DIGHPFTRTMSTNYLSWQPTFGRNSVFIGLTKQQKEELGGVEYRALRLLCCI 465
gi 4809179  430 --dlPTGVSYYGLHSg-----------gDPRNRLNRVMSTNYLSYEPKIGRNSTFVGLSESQKVELGGVEYRSTKVLCLL 496
gi 3724137  371 -----------------------------SAFTKDKMEPTPYLSWEPTLGRNSQFHDLTEEQREELGGIEYRVLKLLQKI 421
gi 1717749  407 ----VLSSAFAKKRE-------------PSISSRHTTMSLPYLSYNPTVDRNSAFVALSKEQRDELGGIEYRALKCVCSM 469
gi 567062   171 -------------------------------------HA------------------IPPKKCTEL--KRSRSVKCLGYV 193
gi 3695407  125 -------------------------------------EG------------------LIK--------IDERASKCLYSV 141
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   785 LVVYYVGWHIVSFVMLVPWINLKKHYSDIVRSDGVSPTWWGFWTAMSAFNDLGLTLTPDSMMSFDKAVYPLIVMIWFIII 864
gi 136231   779 LVVYYVGWHIVAFVMLVPWIILKKHYSEVVRDDGVSPTWWGFWTAMSAFNDLGLTLTPNSMMSFNKAVYPLIVMIWFIII 858
gi 136232   466 LMVYYIGFNILAFVTIVPWACTRHHYSEIIRRNGVSPTWWGFFTAMSAFSNLGLSLTADSMVSFDTAPYPLIFMMFFIII 545
gi 4809179  497 LSIYYLGFSILAMIIFAAWIQPMNNYKEIVRSQGVSPTWWGFWTGMSAFGNLGLTLTPNSMISFHKSIYTLIWMMWFIVI 576
gi 3724137  422 ILCYFFGFFLLGLVGLLPWILHEDRWGQVVDQAGQSRVWWAFFTANSAFMDLGLTLTPDSMNSFNTAVWPLLLMIFLIII 501
gi 1717749  470 VTLYFIIFNIAAFVTFIVFAYTAVGSREVIDSYDLRRGWWALFSSASSFNDLGFSLIPSSFVPMNRNIFLLLISSLFIIA 549
gi 567062   194 VFGYFAMIHVLGFLLVFLYITHVPTASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQMLA 273
gi 3695407  142 VLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLTFSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLM 221
                       890       900       910       920       930       940       950       960
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   865 GNTGFPILLRCIIWIMFKLSPDLSQMRESLGFLLDHPRRCFTLLFPKAATWWLLLTLVGLNFTDWILFIILDFGSTVVKS 944
gi 136231   859 GNTGFPILLRCIIWIMFKISPDLSQMRESLGFLLDHPRRCFTLLFPKAATWWLLLTLAGLNITDWILFIILDFGSTVVKS 938
gi 136232   546 GNTGFPIMLRFIIWIMFKTSRDLSQFKESLGFLLDHPRRCFTLLFPSGPTWWLFTTLVVLNATDWILFIILDFNSAVVRQ 625
gi 4809179  577 GNTGFPIFLRFVIWILFKLSPDLSLRKDSLGFLLDHPRRCFTMLFPKAATWWLFLILIGMNAIDLILFIILDLNTDVVKD 656
gi 3724137  502 GNTGFPVMLRFIIWVMSIVVPRDSGLYEEVRFLLDHPRRCFILLFPSGATWWLFFILIGLNCADVVFFVVLDLGSGPVDA 581
gi 1717749  550 GNTGFPCFFRTFIWTTYKLYPFSFEKKEAMAFLLDHPRRCFTLLFPSGATWVLFFVLLLLNVIDLVLFMVLDTGSKAVAS 629
gi 567062   274 GNTLFPLFLRLLVWFLGRIT----KVKELRLMINNPEEVRFANLLARLPTVFLSSTVVGLVAAGVTMFCAVDWNSSVFDG 349
gi 3695407  222 GNTLFPCFLVLLIWGLYKIT----KRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEG 297
                       970       980       990      1000      1010      1020      1030      1040
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230   945 LSKGYRVLVGLFQSVSTRTAGFSVVDLSQLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYgemggkpedtdt 1023
gi 136231   939 LSKGYRVLVGLFQSVSTRTAGFSVVDLSQLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYgdmggepedtd- 1016
gi 136232   626 VAKGYRALMGLFQSVCTRTAGFNVVDLSKLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYdsgqdde----- 699
gi 4809179  657 LTAGFKVLNGLFQAVSTRTAGFAVLDLSQLHPSVQVSYMLMMYVSVMP-LAISIRRTNVYEEQSLGVYg----------- 724
gi 3724137  582 LPGGIKVLNGLFEAASTRTAGFSCINLAVLHPAVKVSYMIMMYISVLP-IAMSIRRTNVYEEKSLGIYn----------- 649
gi 1717749  630 LPKGIRVVNAIFQSVCTRTAGFTSVSISELHPAVLVSYMVMMYISVYP-VAINMRNTNVYEERSLGVY------------ 696
gi 567062   350 LSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYLPSSAtFAPPSGDTKTTNENTKGKV------------ 417
gi 3695407  298 MSSYEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMIGL------------------------------------ 341
                      1050      1060      1070      1080      1090      1100      1110      1120
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230  1024 eedgdcddedddNEEEESHEGgssqrgkskketk---kkkkrkenenpnEESTKSFIGAHLRRQLSFD-LWFLFLGLFII 1099
gi 136231  1017 --teddgndeddDEENESHEGqssqrsssnnnnnnnrkkkkkkktenpnEISTKSFIGAHLRKQLSFD-LWFLFLGLFII 1093
gi 136232   700 ------nithedDIKETDHDGeseerdtv-------------stkskpkKQSPKSFVGAHLRRQLSFD-LWYLFLGLFII 759
gi 4809179  725 -----------eWEKNQEDDGs---------------------------EKNTKSFIGAHLRRQLSFD-LWYMFLGLFII 765
gi 3724137  650 ------------NPEGEEESAs---------------------------PSSDLSYIGSHLRRQLSFD-LWFIALFFFML 689
gi 1717749  697 --------------RTEDDEG--------------------------------KSFLKDHLTEQLSYD-LWYIFLGLFII 729
gi 567062   418 -----------------KR-G-------------------------------------S-LVQNLAFSpLGCNIIFVMVA 441
gi 3695407  342 ------------------------------------------------------------IVSQLSFL-----TICIFLI 356
                      1130      1140      1150      1160      1170      1180      1190      1200
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136230  1100 CICERDKIKDIQRPNFNVFTILFEIV------SAYGTVGLSLGYPNT--------------NQSFSRQLTTLSKLIIIAM 1159
gi 136231  1094 CICEGDKIKDVQEPNFNIFAILFEIV------SAYGTVGLSLGYPDT--------------NQSFSRQFTTLSKLVIIAM 1153
gi 136232   760 CICEGRKIEDVNKPDFNVFAILFEVV------SAYGTVGLSLGYPNT--------------NTSLSAQFTVLSKLVIIAM 819
gi 4809179  766 CICEGGKIQDPSKPSFTVFQCLFEVV------SAYGTVGLSLGYPGS--------------NQSFSGQFTTISKLVIIAM 825
gi 3724137  690 AISEGTRIMD---GETDMFALMFEVI------SAYGTVGMSLGFSTG--------------NASLSAIFSTTGKVFIIMT 746
gi 1717749  730 CICEGGKISNPLDTDFSIFTVLFEVV------SAYGTVGLSTGLSSS--------------NCSLSARFTTISKLVIIAL 789
gi 567062   442 CITERRRLRN-DPLNFSTLNMIFEVI------SAYGNAGLSTGYSCSrlhqlhpeiicqdkPYSFSGWWSDGGKFVLILV 514
gi 3695407  357 SITERQNLQR-DPINFNVLNITLEVIryfcngSAYGNVGFTTGYSCErrvdisd-ggckdaSYGFAGRWSPMGKFVLIIV 434
                      1210      1220
                ....*....|....*....|
gi 136230  1160 LIRGKNRGLPYSLDRAIILP 1179
gi 136231  1154 LIRGKNRGLPYSLDRAIILP 1173
gi 136232   820 LIRGRNRGLPYTLDRAIMLP 839
gi 4809179  826 LIRGRHRGLPYTLDRAIILP 845
gi 3724137  747 LIRGRHRGLPYGLDRAIVLP 766
gi 1717749  790 ELRGRHRGLPRAVDRAILLP 809
gi 567062   515 MLYGRLKAFTLATGKSWKV- 533
gi 3695407  435 MFYGRFKQFTAKSGRAWILY 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap