Conserved Protein Domain Family
2a6301s02

?
TIGR00943: 2a6301s02 
monovalent cation:proton antiporter
This family of proteins constists of bacterial multicomponent K+:H+ and Na+:H+ antiporters. The best characterized systems are the PhaABCDEFG system of Rhizobium meliloti which functions in pH adaptation and as a K+ efflux system and the MnhABCDEFG system of Staphylococcus aureus which functions as a Na+:H+ antiporter.This family is specific for the phaB and mnhB proteins. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130018
View PSSM: TIGR00943
Aligned: 4 rows
Threshold Bit Score: 130.642
Threshold Setting Gi: 4001726
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001726    28 LFLAGHYTPGGGFVGGLLFASSLVIITIAFDIETMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFI 107
gi 1072396   124 LFLRGHDLPGGGFAAGIAMSIGFILQYMSGGTRWVEERLRIHPLRWMSIGLLVATATGVGSWFFGYPFLTSHAQYASLPV 203
gi 499189986  60 LLWRGHNAPGGGFIAGLMTACALILHRIATGEDALR----TDPARLIPWGAALSFVTGLVPYLLGRPFLKSDYGYFTTAL 135
gi 489321496  29 LFLSGHNAPGGGFVGGLITSSSIVLLLLAYDLKTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPI 108
                         90       100
                 ....*....|....*....|....*..
gi 4001726   108 LEPVHMTTAVFFDFGVLCAVVGTVMTI 134
gi 1072396   204 VGKFPLASAILFDLGVFSLVLGATVLI 230
gi 499189986 136 TGEFEWATAMLFDIGVFAVVVGSTMLI 162
gi 489321496 109 LGKTELATATIFDLGVYLVVVGITMTI 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap