Conserved Protein Domain Family
2a6301s04

?
TIGR00944: 2a6301s04 
Multicomponent K+:H+antiporter
[Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130019
View PSSM: TIGR00944
Aligned: 3 rows
Threshold Bit Score: 514.335
Threshold Setting Gi: 1072398
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728   5 NMLVLTLVIPVITAILLVFIGKR-PIIKRYVALGGTLLTLVAAIINLANVVK-----HGPIRVELGSWKAPYSIVFVLDI 78
gi 1934776   3 NFVILAILIPILSAILLIFMTKN-LMLMRIFSTAASAIGIVISGILVQTVFT-----KGIQTLSLGGWKAPYGIVLAADQ 76
gi 1072398  15 HLLILPILLPLAVAAVLIPINERdRTLKGAIGFASTLVVFILSMILMRLAAAgtgslPGSGVYQLGNWPAPFGIVLVLDR 94
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728  79 FSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLIGIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQL 158
gi 1934776  77 FASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGVSGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQL 156
gi 1072398  95 LSALMLCLTSGLALAAQAYSMARWHTAG--HHFHSLFQLLVAGLNGAFLTGDLFNLFVFFEMMLAASYGLLLHGSGPLRV 172
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728 159 QETIKYVLVNVVSSSFFVMGVAILYSVVGTLNLADISNKLAnlSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYY 238
gi 1934776 157 RESLKYIVFNIVSSALFVIGVGFLYAVTGTLNMADLSVKIS--ESGQTGLITVIGVLLLLVFGMKGGIFPLYFWLPGSYY 234
gi 1072398 173 KAGLHYIAVNLAASALFLIGVSLIYGAAGTLNMADLATKLAalEPRSRTLVEMGSAILGVAFLVKAGMWPLSFWLPTAYA 252
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728 239 APPIPIIAFFGALLTKVGVYAIARTLSLFFSDNV----SFSHYVILFLALLTIIFGCVGAVAYANIKKIILYNVMIAVGV 314
gi 1934776 235 APPAAISALFGALLTKVGLYAITRVFTLIFIHDT----AFTHQLMIWLAALTVIFGVIGSLAYSNVMKIVIYNIITAVGV 310
gi 1072398 253 AATPPVAGVF-AVLTKVGIYVIIRLHLLVFGTAAgassGFGQEWLVTGGMLTIAFGGIGVLASQAMGRLAGYSVLVSSGT 331
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728 315 ILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGT------ADLRQFGGLIKR-------------YPVLGW 375
gi 1934776 311 ILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGT------ASLHKMGGLIKR-------------YPVLGW 371
gi 1072398 332 LLAAVGLGHDGMLAGALFYLVSSTLTIGAFFLLIELVERGRDAgadvlaVTMEAYGDFDEDeeeeevgaaipgtMAVLGL 411
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4001728 376 SFFIAALSLAGIPPLSGFYGKFFIVQSTFER-----------GFYLSGVIVLLSSLVVLYSVIRIFLQGFFGQPK-GYDL 443
gi 1934776 372 MFFISAISLAGIPPLSGFVGKFKIAEGGFAE-----------GEFTISMLILLSSLLVLYSVLRIFIHAFWGEEK-ETPK 439
gi 1072398 412 CFCLCALLLAGLPPLSGFIAKFALISGLFDMpaaelatamsaADWTYVTLLILSGLAAMIAMNRIGIRTFWASIEgTIPR 491
                      490       500
               ....*....|....*....|....
gi 4001728 444 NNKVDVKYLTTIAIVAVVITVLYG 467
gi 1934776 440 PNHRTAKGLLYPAAIFLLLSLLFG 463
gi 1072398 492 VVVIEITPVVVLLGACIFLSLQAG 515
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap