Conserved Protein Domain Family
2a75

?
TIGR00948: 2a75 
L-lysine exporter
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130023
View PSSM: TIGR00948
Aligned: 8 rows
Threshold Bit Score: 164.46
Threshold Setting Gi: 15645340
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1731203     4 LKVAIGPQNAFVLRQGIRREY---VLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNA 80
gi 1731261    15 LIAAIGAQNAFVLRQGIQREH---VLPVVALCTVSDIVLIAAGIAGFGALIGAHPRALNVVKFGGAAFLIGYGLLAARRA 91
gi 1519238     1 MIIPIGAQNAFVLSRGIHRNH---HLLAATLCCLCDLILIGIGVFGGANLLAASPIGLALLTWGGVLFLCWFGIRSLRSA 77
gi 899146      1 MIIPIGAQNAFVLSRGIHRNH---HLLTATLCCLCDLVLIGIGVFGGANLLAASPIGLALLTWGGVLFLGWFGIRSLRSA 77
gi 1723851    15 MILPLGPQNAFVMNQGIRRQY---HIMIALLCAISDLVLICAGIFGGSALLMQSPWLLALVTWGGVAFLLWYGFGAFKTA 91
gi 499584926  14 lllsIGPQNVLVIKQGIKREG---LIAVLLVCLISDVFLFIAGTLGVDLLSNAAPIVLDIMRWGGIAYLLWFAVMAAKDA 90
gi 504719179  83 LILPLGVQNVFIFQQGALQKHiwrALPAVISASVCDTLLIVLAVAGVSVIVQELPVFETVMMAGGFLFLLYMGWVTWNIR 162
gi 446420546  15 LCAAVGAQSLFIVERGMARNY---VFLICALCFMCDIVLMSMGVFGVGAYFAKNLYLSLSLNLFGALFTGFYAFLALKTL 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1731203    81 WR-----------PSGLVPSES----------------------GPAALIGVVQMCLVVTFLNPHVYLDTVVLIGALANE 127
gi 1731261    92 WR-----------PVALIPSGA----------------------TPVRLAEVLVTCAAFTFLNPHVYLDTVVLLGALANE 138
gi 1519238    78 WQg----------QGAALADSP----------------------RLMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQ 125
gi 899146     78 WRg----------QGAKLADSP----------------------QLMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQ 125
gi 1723851    92 MSs----------NIELASAEV----------------------MKQGRWKIIATMLAVTWLNPHVYLDTFVVLGSLGGQ 139
gi 499584926  91 MTnkveapqiieeTEPTVPDDTplggsavatdtrnrvrvevsvdKQRVWVKPMLMAIVLTWLNPNAYLDAFVFIGGVGAQ 170
gi 504719179 163 PN--------------TSQNEK----------------------HTFTPKKQAAFAAAVSLLNPHAILDTIGVIGTSSLQ 206
gi 446420546  92 FQt----------FKKKQVQTP----------------------KKLSLKKTLLFTLGVTLLNPQVYLEMVFLIGASALS 139
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 1731203   128 ESDL-RWFFGAGAWAASVVWFAVLGFSAGRL-QPFFATPAAWRILDALVAVTM 178
gi 1731261   139 HSDQ-RWLFGLGAVTASAVWFATLGFGAGRL-RGLFTNPGSWRILDGLIAVMM 189
gi 1519238   126 FAEPlRPAFAAGAMLASLVWFYSLAFGAAAL-SPWLARGRVQQAIDTIVGLIM 177
gi 899146    126 FAEElRSAFAAVAMLASLVWFYSLAFGAVVL-SPWLARSRQGYSKLLILLLVS 177
gi 1723851   140 LDVEpKRWFALGTISASFLWFFGLALLAAWL-APRLRTAKAQRIINLVVGCVM 191
gi 499584926 171 YGDTgRWIFAAGAFAASLIWFPLVGFGAAAL-SRPLSSPKVWRWINVVVAVVM 222
gi 504719179 207 YSGLeKWLFMAACIAVSWIWFISLAIAGRLF-QTIDTSGRLMLIVNKCSAAVM 258
gi 446420546 140 FNLAqKFVFLAGTLSAALSWLLLLCTLSLRYgSKLLNNQKIFMGVNLFVTAIM 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap