3BXY


Conserved Protein Domain Family
dapD

?
TIGR00965: dapD 
Click on image for an interactive view with Cn3D
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
This enzyme is part of the diaminopimelate pathway of lysine biosynthesis. Alternate name: tetrahydrodipicolinate N-succinyltransferase. The closely related TabB protein of Pseudomonas syringae (pv. tabaci), SP|P31852|TABB_PSESZ, appears to act in the biosynthesis of tabtoxin rather than lysine. The trusted cutoff is set high enough to exclude this gene. Sequences below trusted also include a version of this enzyme which apparently utilize acetate rather than succinate (EC: 2.3.1.89). [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130038
View PSSM: TIGR00965
Aligned: 4 rows
Threshold Bit Score: 485.171
Threshold Setting Gi: 6647496
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BXY_A        14 QLQNIIETAFERRAEITP-ANADTVTREAVNQVIALLDSGALRVAEKI-DGQWVTHQWLKKAVLLSFRINDNQVIEGAES 91
gi 2506339     3 QLQNIIETAFERRAEITP-ANADTVTREAVNQVIALLDSGALRVAEKI-DGQWVTHQWLKKAVLLSFRINDNQVIEGAES 80
gi 488153667   2 SLQNIIETAFENRADITP-TTVTPEVKEAVLETIRQLDSGKLRVAERLgVGEWKVNEWAKKAVLLSFRIQDNEVLNDGVN 80
gi 6647496     3 YIIKEIEEAWQIKENILHdSSKLIKLKKILNESIASLNQGIIRVCEKQ-GNQWKVNEWVKKAILLYFITTESQLYNNNYN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BXY_A        92 RYFDKVPMKF-ADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS 170
gi 2506339    81 RYFDKVPMKF-ADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS 159
gi 488153667  81 KYFDKVPTKF-ADWSEDEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLS 159
gi 6647496    82 SWYDKVAPKFpADTDKNIFKEAAIRKVPGAIVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHIS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BXY_A       171 GGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGNLP 250
gi 2506339   160 GGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLP 239
gi 488153667 160 GGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239
gi 6647496   162 GGAGIGGVLEPLQAKPVIIEDNCFVGARSEIAEGVIVEEGSVISMGVFIGSSTKIVYRDTGEIIYGRIPAYSVVVPGILP 241
                        250       260       270
                 ....*....|....*....|....*....|...
3BXY_A       251 S-KDGKYSLYCAVIVKKVDAKTRGKVGINELLR 282
gi 2506339   240 S-KDGKYSLYCAVIVKKVDAKTRGKVGINELLR 271
gi 488153667 240 S-KDGSHSLYCAVIVKRVDAQTRAKTSVNELLR 271
gi 6647496   242 PpEVGKPGLYCVVIVKQVDKTTRGKVSINDLLR 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap