Conserved Protein Domain Family
3a0106s01

?
TIGR00968: 3a0106s01 
sulfate ABC transporter, ATP-binding protein
[Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 130041
View PSSM: TIGR00968
Aligned: 5 rows
Threshold Bit Score: 440.39
Threshold Setting Gi: 3023607
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506100     3 IEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARDRKVGFVFQH 82
gi 2492538     3 IIINNVSKQFGDFTALKDINLEVPDGKLVALLGPSGSGKSTLLRAIAGLEEPDQGQIIINGQDATHVDIRKRNIGFVFQH 82
gi 3023607     3 ILIENISKRFGSFQALDRVNLEIKNGSLVGLLGPSGSGKSTLLRVLAGLEKPDSGRIWLEGQDATQMKLQDREIGFVFQN 82
gi 499697404   3 IQVSQVSKQFGSFQAVKDVDLTVETGSLVALLGPSGSGKSTLLRLIAGLEQPDSGRIFLTGRDATNESVRDRQIGFVFQH 82
gi 685915414   5 IVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGTITINGRDVTRVPPQRRGIGFVFQH 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506100    83 YALFRHMTVFDNIAFGLTVLprreRPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDE 162
gi 2492538    83 YALFKHLTIRQNIAFGLEIR----KHPPAKTKERVEELLSLIQLEGLGNRYPSQLSGGQRQRVALARALAVQPQVLLLDE 158
gi 3023607    83 YALFPHLTVSENVAFGLEIQ----KIDSLLKKKRVNELLKLMQLEKFGDSYPNQLSGGQRQRVALARALAMEPKVLLLDE 158
gi 499697404  83 YALFKHLTVRKNIAFGLELR----KHTKEKVRARVEELLELVQLTGLGDRYPSQLSGGQRQRVALARALAVQPQVLLLDE 158
gi 685915414  85 YAAFKHLTVRDNVAFGLKIR----KRPKAEIKAKVDNLLQVVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506100   163 PFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFMGEVNR 242
gi 2492538   159 PFGALDAKVRKELRAWLRKLHDEVHLTSVFVTHDQEEAMEVADEIVVMSNGKIEQVGTAEEIYEHPASPFVMGFIGEVNV 238
gi 3023607   159 PFAALDAKIRKQLRSWLRELHHKISVTTVFVTHDYSEAMELAQEIVLLENGKIIQIGSAQELSDHPTNTFVTNFLGLK-- 236
gi 499697404 159 PFGALDAKVRKDLRSWLRKLHDEVHVTTVFVTHDQEEAMEVADQIVVMNHGKVEQIGSPAEIYDNPATPFVMSFIGPVNV 238
gi 685915414 161 PFGALDAKVREELRAWLRRLHDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST 240

                 .
gi 2506100   243 L 243
gi 2492538   239 L 239
gi 3023607       -
gi 499697404 239 L 239
gi 685915414 241 L 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap