Conserved Protein Domain Family
3a0106s03

?
TIGR00971: 3a0106s03 
sulfate/thiosulfate-binding protein
This model describes binding proteins functionally associated with the sulfate ABC transporter. In the model bacterium E. coli, two different members work with the same transporter; mutation analysis says each enables the uptake of both sulfate and thiosulfate. In many species, a single binding protein is found, and may be referred to in general terms as a sulfate ABC transporter sulfate-binding protein. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 130044
View PSSM: TIGR00971
Aligned: 5 rows
Threshold Bit Score: 573.836
Threshold Setting Gi: 322613814
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118148     13 LVASLLL---AghvQATELLNSSYDVSRELFAALNPPFEQQWAKDNGgDKLTIKQSHAGSSKQALAILQGLKADVVTYNQ 89
gi 4323056    12 LASTSVL---A---KDIQLLNVSYDPTRELYEQYNKAFAAHWKQETG-DNVVVRQSHGGSGKQATSVINGIEADVVTLAL 84
gi 33302617   12 LAATSVM---A---KDIQLLNVSYDPTRELYEQYNKAFSAHWKQQTG-DNVVIRQSHGGSGKQATSVINGIEADVVTLAL 84
gi 446429213   7 LASTSIL---A---KDIQLLNVSYDPTRELYEQYNKAFSAHWKQETG-DNVVIRQSHGGSGKQATSVINGIEADVVTLAL 79
gi 446212429  13 LAAMLLLvgqA---QATELLNSSYDVSRELFAALNPPFEQQWAKENGgDKLTIKQSHAGSSKQALAILQGLKADVVTYNQ 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118148     90 VTDVQILHDKGKlIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAA 169
gi 4323056    85 AYDVDAIAERGR-IDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIKDWNDLIKPGVSVITPNPKSSGGARWNYLGAWGYA 163
gi 33302617   85 AYDVDAIAERGR-IDKEWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYA 163
gi 446429213  80 AYDVDAIAERGR-IDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYA 158
gi 446212429  90 VTDVQILHDKGKlIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYLAAWGAA 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118148    170 DKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVA 249
gi 4323056   164 LHHNNGDQAKAQEFVKALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLATHELGKDKFEIVTPSESILAEPTVS 243
gi 33302617  164 LHHNNNDQAKAQDFVRALYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAANELGKDKFEIVTPSESILAEPTVS 243
gi 446429213 159 LHHNNNDQAKAQDFVKALFKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKDKFEIVTPSESILAEPTVS 238
gi 446212429 170 DNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVA 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118148    250 WVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYRVNNPEVMDKLKDKFPQTELFRVEDKFGSWPEVMKTHFTSGGEL 329
gi 4323056   244 VVDKVVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFYRPRDAAVAKKYEGEFPKLKLFTIDDVFGGWTKAQKEHFSNGGTF 323
gi 33302617  244 VVDKVVEKKGTKEVAEAYLKYLYSPEGQEIAAKNYYRPRDAEVAKKYENAFPKLKLFTIDEEFGGWTKAQKEHFANGGTF 323
gi 446429213 239 VVDKVVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFYRPRDADVAKKYDDAFPKLKLFTIDEVFGGWAKAQKDHFANGGTF 318
gi 446212429 250 WVDKNVQANGTEKAAKAYLNWLYSPQAQTIITHYYYRVNNPEIMGKQADKFPQTELFRVEDKFGSWPEVMKTHFASGGEL 329

                 ...
gi 118148    330 DKL 332
gi 4323056   324 DQI 326
gi 33302617  324 DQI 326
gi 446429213 319 DQI 321
gi 446212429 330 DKL 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap