Conserved Protein Domain Family
citramal_synth

?
TIGR00977: citramal_synth 
citramalate synthase
This model includes GSU1798 and is now known to represent citramalate synthase. Members are related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distinct. The role is isoleucine biosynthesis, the first dedicated step. [Unknown function, General]
Statistics
?
PSSM-Id: 130050
View PSSM: TIGR00977
Aligned: 3 rows
Threshold Bit Score: 999.799
Threshold Setting Gi: 7387865
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863   7 SLWLYDTTLRDGAQREGISLSLTDKLTIARRLDQLGIPFIEGGWPGANPKDVQFFWQLQEEPLEQAEIVAFCSTRRPHKA 86
gi 7387854   4 KVYIYDTTLRDGSQMEGVSFSLEDKIRIAEKLDDFGIHYIEGGWPYANPKDNLFFQKAKKMNFKNAKLTAFGSTRRPNKK 83
gi 7387865   2 SIKVYDTTLRDGAQAFGVSFSLEDKIRIAEALDDLGVHYLEGGWPGSNPKDIAFFEAVKGMNFKNLKVAAFSSTRRPDVK 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863  87 VETDKMLQAILSAGTRWVTIFGKSWDLHVLEGLQTSLAENLAMISDTIAYLRSQGRRVIYDAEHWFDGYRANPDYALATL 166
gi 7387854  84 VSEDPQVESLIKAETPVVTIFGKSWDLHVTDALKTTLEENLNMIYETVEYLKRYVDEVIFDAEHFFDGYKSNPEYALQVL 163
gi 7387865  82 IEEDANIQTLIKAETPVYTIFGKSWDLHVEKALRTTLEENLKMIYDTVSYLKRFADEVIYDAEHFFDGYKANREYALKTL 161
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863 167 ATAQQAGAEWLVMCDTNGGTLPGQISEITTKVRRSLgldgqsdRQPQLGIHAHNDSGTAVANSLLAVEAGATMVQGTING 246
gi 7387854 164 EAALKGGADWVVLCDTNGGTLPHEIYEITKKVKERF-------KDANVGIHAHNDSETAVANSLMAVLAGARQVHGTING 236
gi 7387865 162 KVAEEAGADCLVLADTNGGTLPHEIEEIIEDVKKHV-------KAP-LGIHAHNDSDVAVANTLAAVRKGAVHVQGTING 233
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863 247 YGERCGNANLCTLIPNLQLKLDYDCIEPEKLAHLTSTSRLISEIVNLAPDDHAPFVGRSAFAHKGGIHVSAVQRNPFTYE 326
gi 7387854 237 IGERTGNANLCSIIPNLQLKLGFDVIPQENLKKLTELANFVAEIINMPLPRNMPYVGESAFAHKGGVHASAVLKNAKTYE 316
gi 7387865 234 LGERCGNANLCSVIPNLVLKMGLEVIPKENLKKLFDVAHLVAELSGRPHIENMPYVGDYAFAHKGGVHVSAIKRDPRTYE 313
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863 327 HIAPNLVGNERRIVVSEQAGLSNVLSKAELFGIALDRQNPACRTILATLKDLEQQGYQFEAAEASFELLMRQAMGDRQPL 406
gi 7387854 317 HINPELVGNKRKITVSDLAGRSNLVHKLKEFGIEIDPKSPELKKLIDKIKELEKEGYHFEAAEASLELLIKRHFGLVKDY 396
gi 7387865 314 HIDPELVGNRRIISISELSGKSNVLEKIKEMGFEIDESSPKVREILKKIKELEAQGYHFEGAEASFELLVRDMLGKRKKY 393
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387863 407 FLVQGFQVHCDLLTPAenpAYRNALATVKVTVNGQN--------ILEVAEGNGPVSALDQALRKALTRFYPQIADFHLTD 478
gi 7387854 397 FDFDAYRVLIAKRRDD---SLPTSEATVRLSVEGVE--------EHTASLGNGPISALDRALRKALEEFYPNLKELQLID 465
gi 7387865 394 FEFLGFTVMTIKNRDEe--SFSEATVKVRVPDEVAKrlghdepfEHTAAEGEGPVEALDRAVRKALEKFYPSLKDTKLTD 471
                      490       500       510       520       530       540
               ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7387863 479 YKVRILDGGAGTSAKTRVLVESSNGDRRWTTVGVSGNILEASYQAVVEGIEYGLRLLTCGLTN 541
gi 7387854 466 YKVRIINESAGTSAKVRVLIESTDGKRKWGTVGVSENVIEASWIALRDSIVYKLMKDEEEGIL 528
gi 7387865 472 YKVRILNEQAGTKATTRVLIESSDGKRRWGTVGVSPNIIEASWTALLESLEYKLHKDEEEMRN 534
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap