1VS5


Conserved Protein Domain Family
rpsL_bact

?
TIGR00981: rpsL_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S12, bacterial/organelle
This model recognizes ribosomal protein S12 of Bacteria, mitochondria, and chloroplasts. The homologous ribosomal proteins of Archaea and Eukarya, termed S23 in Eukarya and S12 or S23 in Archaea, score below the trusted cutoff. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130054
View PSSM: TIGR00981
Aligned: 15 rows
Threshold Bit Score: 195.39
Threshold Setting Gi: 2500446
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VS5_L         1 MATVNQLVRKPRARKVAKSNVPALEA-------------CPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYI 67
gi 6094151     1 MPTINQLTRIGRKAVFSRTKSPALQA-------------CPQKRGVCTRVMTVTPKKPNSALRKVARVRLSSGVEVTAYI 67
gi 7388119     1 MPTINQLIRKRRKSSLARKKSPALQK-------------CPQKRGVCLQVKTKTPKKPNSALRKVAWVRLSNGQEVIAYI 67
gi 730629      1 MPTYNQLVRFGRKSKTRKTKSPALES-------------NPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYI 67
gi 6226057     1 MPTFNQLVKYGREKRKKKSKAPALQG-------------CPQKRGVCVRVYTVTPKKPNSALRKVARVRLSNGIEVTAYI 67
gi 2500444     1 MPTINQLIRKERKKVVKKTKSPALVE-------------CPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYI 67
gi 2500447     1 MPTIQQLIRSERSKVQKKTKSPALKQ-------------CPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYI 67
gi 730628      1 MPTIQQLVRKGRRDKISKVKTAALKG-------------SPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYI 67
gi 488733086   1 MPTINQLIRKPRKSQTEKTASPALQN-------------CPQRRGICTRVMTVTPKKPNSALRKVARVRLSNGFEVTAYI 67
gi 1644221     1 MPTINQLIRKGRVSKVENSKSPALNKgynsfkkehtnvsSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
1VS5_L        68 GGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA 124
gi 6094151    68 PGIGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGAKDTLGVVDRKRGRSKYGAKRPRA 124
gi 7388119    68 GGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDCAAVKNRKQSRSRYGAKRPK- 123
gi 730629     68 PGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAHRKQV 124
gi 6226057    68 PGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGTKRPKE 124
gi 2500444    68 PGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKA 124
gi 2500447    68 PGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGTKREKA 124
gi 730628     68 PGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG 124
gi 488733086  68 PGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDTLGVNNRKKGRSKYGTKKPKA 124
gi 1644221    81 PGIGHNLQEHSVVLIRGGRVKNLPRVRYHIVRGALDTAGVENRAQGRPKYGTKKPKA 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap