Conserved Protein Domain Family
3a0801s02tim23

?
TIGR00983: 3a0801s02tim23 
mitochondrial import inner membrane translocase subunit tim23
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130056
View PSSM: TIGR00983
Aligned: 4 rows
Threshold Bit Score: 193.131
Threshold Setting Gi: 603056
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417274   61 LAG-LDKGVEYLDLEEEQLSSLEGSQgliPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLN 139
gi 5748689  47 LAD-LDKPLDYLLIEEDALSTLPGDSmaiPSRGWQDDLCYGTGTSYLSGLAIGGLWGLNEGMKKTKDITSTRLRLNGILN 125
gi 603056   34 LYK-LPTSPEFLFTEEALR----------QRRSWGENLTFYTGTAYLGGSVAGASVGVITGVKSFESGDTTKLKINRILN 102
gi 2335039  42 LSPyLNVDPRYLVQDTDEFILPTGAN---KTRGRFELAFFTIGGCCMTGAAFGALNGLRLGLKETQSMPWSKPRNVQILN 118
                       90       100       110       120       130       140       150
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 417274  140 HITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVW 212
gi 5748689 126 GVTRRGPFVGNSLGVLALVYNGINSLIGYKRQKHGWENSVAAGALTGALYKSTRGLRAMAISSSLVATAAGIW 198
gi 603056  103 SSGQTGRTWGNRIGIIGLVYAGIESGIVAATDRDDVWTSVVAGLGTGAVCRAARGVRSAAVAGALGGLAAGAV 175
gi 2335039 119 MVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDFNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSVY 191
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap