Conserved Protein Domain Family
3a0801s03tim44

?
TIGR00984: 3a0801s03tim44 
mitochondrial import inner membrane, translocase subunit
The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents.These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tim proteins. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130057
View PSSM: TIGR00984
Aligned: 4 rows
Threshold Bit Score: 530.217
Threshold Setting Gi: 400272
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6016371    41 DTFRAELKKSQELQDSVKALQDSSGSLSESDTFKKARDAYEKARSGTTAASSFTGKTVGKAGAKIGSYAQKAWESAPVQL 120
gi 342187045  65 DNIKQELAKNKEMKESIKKFRDEAKKLEESDALQEARRKYKSIESETVRTSEAIKKKLGELTGTVKESLDEVSKSDLGRK 144
gi 6016367    44 DNVRDEMQKNKELQEHQQQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEAGKK 123
gi 400272     56 DTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRG----STIVGKTLKKTGETMEHIATKAWESELGKN 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6016371   121 SKKVISSTANTV---ATGVDTATKPVRETAFYKTIKQTMSDGSTSSRYGFYADKEQRKKLRE-EFERR--NRMFASSARI 194
gi 342187045 145 IKEGVEEAARTAkqsAESVSKSGEKLGKTAAFKAISQGVESVKKELDESVLGQTGPYRRPERlRKRTEfaGAKFKESKVF 224
gi 6016367   124 MTEAGAEALKQArkaAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDN--IADVRMYSRPEAlTKRTD--GFDLEKERVV 199
gi 400272    132 TRKAAAATA-------KKLDESFEPVRQTKIYKEVSEVIDDG-ESSRYGGFITKEQRRLKRErDLASG--KRHRAVKSNE 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6016371   195 QPNEDVQSVVVHSNPSWKNKVEQIKNESRLVRKIQELK-KSYQESEHPIVSSIRDMADSISGVWSRMFSETEASQVMRRF 273
gi 342187045 225 EANEEALGVVLHKDSKWYQQWKDFKDNNVVFNRFFEMK-MKYDESDNVLIRASRALTDKVTDLLGGLFSKTEMSEVLTEI 303
gi 6016367   200 EANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWK-IKYDESDNMAVRMMRGVTEKIGSVFSG---QNEVSEVLTEI 275
gi 400272    202 DAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKnKLWDESENPLIVVMRKITNKVGG----FFAETESSRVYSQF 277
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6016371   274 KEIDPSFNTEHFLQYLREYIVPEVTEAYVKGDKEVLKTWLSEAPFSVYETTTKEYAKHGVVSV-GKILDIRGVDIMSQRL 352
gi 342187045 304 LRVDPTFDKDHFLHQCETDIIPNILEAMISGELDILKDWCYEATYSQLAHPIQQAKALGFQFH-SRILDISNVDLAMGKM 382
gi 6016367   276 HKIDANFDKQEWLRFCETKIIPNILEAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKdSRIIDINKVEMATGKM 355
gi 400272    278 KLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYAD-GRILDIRGVEIVSAKL 356
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 6016371   353 LQPNdiPVFIVTFRTQEVHMFKDASsGELVAGKDDRIQQCTYASVFTRVEDELDnpETRGWRIVD 417
gi 342187045 383 MEQG--PVLIVTFQAQVVMVIKNSK-GEVYDGDPDKVQRMLYVWALCRDQEELN--PYAAWRLLD 442
gi 6016367   356 MEQG--PVLIISFQVYMINVTKNAD-GKVVEGDPDNPKRINHIWVLCRDVEEYN--PALAWKLLE 415
gi 400272    357 LAPQdiPVLVVGCRAQEINLYRKKKtGEIAAGDEANILMSSYAMVFTRDPEQIDddETEGWKILE 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap