Conserved Protein Domain Family
3a0801s07tom40

?
TIGR00989: 3a0801s07tom40 
mitochondrial import receptor subunit Tom40
The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents.These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom40 proteins. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130062
View PSSM: TIGR00989
Aligned: 3 rows
Threshold Bit Score: 283.318
Threshold Setting Gi: 127218
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124912   57 LVNPGTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALFANDNLFAQGNIDNDLS 136
gi 2257553  27 LINPGTCENLSKEVSKDILLSNYAFTGVRADVTKGFCTSPWFTVSHAFALGSQVLPPYSFSTMFGGEPLFLRGSVDNDGA 106
gi 127218   38 LSNPGTIETIAREVQRDTLLTNYMFSGLRADVTKAFSLAPLFQVSHQFAMG-ERLNPYAFAALYGTNQIFAQGNLDNEGA 116
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124912  137 VSGRLNYGWDKKNISKVNLQISDGQ-PTMCQLEQDYQASDFSVNVKTLNPSFSEKgeFTGVAVASFLQSVTPQLALGLET 215
gi 2257553 107 VQAMLNCTWNSNVLSKVQMQLSNGAvPNMCQIEHDHKGKDFSFSFKAMNPWYEEK--LTGIYIISLLQSVTPKLSLGVEA 184
gi 127218  117 LSTRFNYRWGDRTITKTQFSIGGGQ--DMAQFEHEHLGDDFSASLKAINPSFLDGg-LTGIFVGDYLQAVTPRLGLGLQA 193

               ...
gi 124912  216 LYS 218
gi 2257553 185 LWQ 187
gi 127218  194 VWQ 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap